KEGG   Salmonella enterica subsp. enterica serovar Newport USMARC-S3124.1: SN31241_28330Help
Entry
SN31241_28330     CDS       T02779                                 

Definition
Thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
senn  Salmonella enterica subsp. enterica serovar Newport USMARC-S3124.1
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:senn00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SN31241_28330
Enzymes [BR:senn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     SN31241_28330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2867176..2867793)
Genome map
AA seq 205 aa AA seqDB search
MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTVVYTAEIDDRFGAGKVSSRIGLSSPAK
LFNQNTSLFEEIRAESARQTIHCVLVDESQFLTRQQVYQLSEVVDKLDIPVLCYGLRTDF
RGELFVGSQYLLAWSDKLVELKTICFCGRKASMVLRLDQDGRPYNEGEQVVIGGNERYVS
VCRKHYKDALEEGSLTAIQERHRHI
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggcacagctatatttctactattcggcaatgaatgcgggtaagtcgactgcactgctg
caatcttcatacaattatcaggaacgcgggatgcgtaccgtcgtatatacggcggaaatc
gacgatcgtttcggcgcaggcaaagtcagctctcgtatcggtttgtcgtcgccggcaaaa
ttgtttaaccaaaatacatccttgtttgaagagattcgtgccgagagcgcgcggcagaca
atacattgcgtgttagtcgacgaaagccagtttttgactcgccagcaggtttatcaatta
tccgaggttgtcgacaaattagatattccagtactttgctatgggctacgaacagacttt
cgtggggagctctttgtcggcagccaatacttgctggcatggtcagataagctggtggaa
ttaaaaactatctgtttctgcggtcgtaaagccagtatggttctgcgccttgatcaggac
ggcaggccttataacgaaggcgaacaggtggttattggcgggaatgaacgctacgtttca
gtttgccgtaagcattataaggacgcgctggaggagggctcactgacggcgattcaggag
cgtcatcggcacatatga

  All links  
No link information was found.   
DBGET integrated database retrieval system