KEGG   Salmonella enterica subsp. enterica serovar Newport USMARC-S3124.1: SN31241_28790Help
Entry
SN31241_28790     CDS       T02779                                 

Definition
Glutamate dehydrogenase
Orthology
K00261  
glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
senn  Salmonella enterica subsp. enterica serovar Newport USMARC-S3124.1
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Nitrogen metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:senn00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    SN31241_28790
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SN31241_28790
   00330 Arginine and proline metabolism
    SN31241_28790
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    SN31241_28790
Enzymes [BR:senn01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.3  glutamate dehydrogenase [NAD(P)+]
     SN31241_28790
Exosome [BR:senn04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   SN31241_28790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2916779..2918053
Genome map
AA seq 424 aa AA seqDB search
MDKLSYASDSSTSAWNTYLQQIERVAPYLGELSPWVDTLRHPKRALIVDIPVQMDDGTIR
HFEGYRVQHNLSRGPGKGGVRYHPDVDLNEVMALSAWMTIKCAALNLPYGGAKGGIRVDP
FSLSEGELERLTRRYTSEIGIIIGPQKDIPAPDVGTNGKVMAWMMDTYSMNHGTTVTGVV
TGKPIHLGGSLGREKATGRGVFVSGLEAARRANIAVEGARVAVQGFGNVGSEAARLFAGA
GARVVAIQDHTATLFNATGIDMKALTAWQTEHKQIAGFPGAETIASDAFWRLEMDILIPA
ALEGQITRQRAEALTCKLVLEGANGPTYPDADDVLASRGILVVPDVVCNAGGVTVSYFEW
VQDMASFFWSEEEINARMDKIMTDAIVHVWEKAAEKSCSLRTAAYIVACERILLARKDRG
IYPG
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggataagttatcttacgcttcagatagcagcacatctgcctggaatacctacctgcaa
caaatcgagcgtgtggccccttatctgggcgagttatccccctgggtggatactctgcgc
cacccaaaacgcgctctgatcgtcgatattccggtacaaatggatgatggcactattcgt
catttcgaaggatatcgcgtgcagcacaacctctcccgaggtccgggtaaaggcggtgtt
cgctaccatcctgacgttgatctcaatgaagtgatggccctgtcagcatggatgaccatc
aaatgtgccgcgctgaatctgccgtacggcggcgccaaaggcggcatccgcgtcgatccg
ttctcgctgtcggaaggtgaactggagcgtttgacccgccgctataccagcgagatcggc
attatcatcgggccgcagaaagatattcctgcgccggatgtcggcaccaacggtaaagtg
atggcctggatgatggatacgtattccatgaatcatggcacgacggtcactggcgtcgtc
accggtaagcctatccatcttggcggttcgctgggccgtgaaaaagcgacggggcgcggc
gttttcgtcagcgggctggaagccgcacgtcgggcgaatattgctgttgaaggcgctcgc
gttgcggttcagggttttggtaacgtcggcagcgaagccgcgcgtctgtttgcaggcgct
ggcgcccgtgtcgtggcgattcaggatcataccgcgaccctgtttaacgccaccggtatt
gacatgaaggcgctcacggcatggcagacagaacacaaacagatagccggtttcccgggc
gcggaaactatcgccagcgatgcgttctggcgtctggagatggatattctgatcccggcg
gcgcttgaaggccagataactcgtcagcgcgcggaagccctgacgtgtaagctggtgctg
gaaggggctaacggcccgacctatccggatgctgatgatgttctggccagccgtggtatc
cttgtggtgcctgacgtggtctgtaacgcaggcggcgtaaccgtcagctacttcgaatgg
gtacaagatatggccagcttcttctggagcgaagaagagatcaacgcgcgcatggacaaa
atcatgaccgacgctatcgtccatgtctgggagaaagcggctgagaaatcctgttctctg
cgcaccgcagcctatattgtcgcctgtgagcgcattctgttggcccgtaaagatcgcggt
atctatccgggttaa

DBGET integrated database retrieval system