KEGG   Salmonella enterica subsp. enterica serovar Newport USMARC-S3124.1: SN31241_41560Help
Entry
SN31241_41560     CDS       T02779                                 

Definition
Thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
senn  Salmonella enterica subsp. enterica serovar Newport USMARC-S3124.1
Brite
Enzymes [BR:senn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     SN31241_41560
Secretion system [BR:senn02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   SN31241_41560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(4212833..4213546)
Genome map
AA seq 237 aa AA seqDB search
MKKRFMMFTLLAAAFSGVAHADDAAIRQSLAKLGVQSTEIQSSPVAGMKTVLTHSGVLYV
TDDGKHIIQGPMYDVSGAHPVNVTNKLLMSQLNALEKEMIVYKAPDEKHVITVFTDITCG
YCHKLHEEMKDYNALGITVRYLAFPRQGLESQAEQDMKSIWCAKDKNKAFDDAMAGKGVK
PASCDVNIADHYALGVQLGVSGTPAIVLSNGYVVPGYQGPKEMQAFLDEHQKQTSGK
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagcgttttatgatgttcactttactggcggcggcgttttcaggcgtggcccat
gcggatgatgcggctatccgtcagtcgctggctaagctgggcgttcagagtacggaaatt
cagtcctcgccagtggcagggatgaaaaccgtcctcactcacagcggcgtactgtacgtc
actgatgacggcaaacatattattcaagggccgatgtatgacgtgagcggcgcgcatccg
gtaaacgtgacgaacaaactgctgatgagccagctaaatgcgctggaaaaagagatgatc
gtctataaagcgccggatgagaaacatgtcattactgtttttaccgatatcacctgcggc
tattgtcataagctacatgaagagatgaaagattataacgcgctggggatcacggtacgt
tatctggcttttccgcgccaggggctggaaagccaggcggagcaggatatgaaatctatc
tggtgcgccaaagacaaaaacaaagcgtttgatgacgccatggcaggtaagggcgtgaaa
ccggcaagctgtgacgtgaacattgctgatcattatgcgttgggcgtgcagttgggcgtt
agcggtacgccagccattgtattgagtaacggctatgtggtgcctggctatcagggaccg
aaagagatgcaagcgtttcttgatgagcatcaaaaacagaccagtggtaaataa

DBGET integrated database retrieval system