KEGG   Salmonella enterica subsp. enterica serovar Newport USMARC-S3124.1: SN31241_46440Help
Entry
SN31241_46440     CDS       T02779                                 

Definition
Lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
senn  Salmonella enterica subsp. enterica serovar Newport USMARC-S3124.1
Brite
Enzymes [BR:senn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     SN31241_46440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(4716920..4717402)
Genome map
AA seq 160 aa AA seqDB search
MAVVLALAALVPDFRLLHTSPEGLALIADLEGCRLRPYQCSAGVWTSGIGHTAGVVPKRD
ITEKEAAANLVADVLNVEKRLAVCVPVDMPPAVYDALVSFAFNVGTGAACRSTLVYHLKH
RQWWQACDQLTRWVFVNGERNTGLENRRFRERTYCLKGAK
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
gtggccgtcgtgctggcgctggcggcactggtgcctgattttcgtttgcttcacacctcg
ccggaggggctcgcgctgattgccgacctcgaggggtgccggttgcgcccttaccagtgc
agcgcgggcgtgtggacgtcaggcatcggccacactgccggggtggtaccgaaacgggat
atcaccgagaaggaagccgccgcgaatctggtcgccgacgtgctgaatgttgagaaacga
ctcgcggtctgtgtgccggtggatatgccacccgccgtctatgacgcgctggtcagcttc
gcttttaacgtcggcaccggcgcggcctgtcgctcaacactggtgtatcacctgaaacac
cggcaatggtggcaagcctgtgaccagctcacccgctgggtgtttgtgaatggtgagcgt
aataccgggctcgaaaatcgccgctttcgcgagcgcacttactgcctgaagggggcgaaa
tga

DBGET integrated database retrieval system