KEGG   Salmonella enterica subsp. enterica serovar Newport USMARC-S3124.1: SN31241_830Help
Entry
SN31241_830       CDS       T02779                                 

Definition
DeoK
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
senn  Salmonella enterica subsp. enterica serovar Newport USMARC-S3124.1
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:senn00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SN31241_830
Enzymes [BR:senn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SN31241_830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
84606..85526
Genome map
AA seq 306 aa AA seqDB search
MDIAVIGSNMVDLITYTNQMPKEGETLEAPAFKIGCGGKGANQAVAAAKLNSKVLMLTKV
GDDIFADNTIRNLESWGINTTYVEKVPCTSSGVAPIFVNANSSNSILIIKGANKFLSPED
IDRAAEDLKKCQLIVLQLEVQLETVYHAIEFGKKHGIEVLLNPAPALRELDMSYACKCDF
FVPNETELEILTGMPVDTYDHIRAAARSLVDKGLNNIIVTMGEKGALWMTRDQEVHVPAF
RVNAVDTSGAGDAFIGCFAHYYVQSGDVEAAMKKAVLFAAFSVTGKGTQSSYPSIEQFNE
YLSLNE
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggatatcgcggttattggctctaacatggtggaccttatcacctacaccaaccagatg
cccaaagaaggggaaactctggaagcgccggcgtttaaaatcggctgcggcggaaaaggg
gcgaaccaggccgtggcggccgctaagctcaattcaaaagtattgatgttgaccaaagtg
ggcgacgatatttttgccgacaacaccattcgtaatctcgaatcctgggggatcaatacg
acgtatgtagaaaaagtaccgtgtaccagcagcggcgtagcgccgattttcgtcaacgcc
aactccagcaacagcattctgatcatcaaaggcgctaacaagtttctctcgccggaagat
atcgatcgcgcggcggaagatttaaaaaaatgccagcttattgttctgcaactggaagtt
cagcttgaaacggtttatcacgcaatagaatttggcaagaaacacgggattgaagtgtta
ttaaaccctgcgccagcattacgggaattagatatgtcttatgcctgtaaatgcgatttc
tttgtacccaatgaaaccgagctggaaatattaaccggtatgccagtggatacctatgac
catattcgcgcagcggcacgttcgctggtagataaagggctgaacaatattattgtcacc
atgggtgagaaaggcgcgctgtggatgacgcgtgaccaggaagtccatgttccggcgttt
cgagtgaacgctgtcgataccagcggcgcgggcgatgcctttatcggctgtttcgcgcat
tactacgtccagagcggggatgtggaagccgccatgaaaaaagccgtcctctttgccgct
ttcagcgtcaccgggaaaggcacccaatcctcttatccaagtattgagcaatttaatgag
tatctttcgttgaacgaataa

DBGET integrated database retrieval system