KEGG   Salmonella enterica subsp. enterica serovar Typhimurium DT2: STMDT2_35481Help
Entry
STMDT2_35481      CDS       T02869                                 

Gene name
malS
Definition
alpha-amylase (EC:3.2.1.1)
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
senr  Salmonella enterica subsp. enterica serovar Typhimurium DT2
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:senr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    STMDT2_35481 (malS)
Enzymes [BR:senr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     STMDT2_35481 (malS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3809460..3811487
Genome map
AA seq 675 aa AA seqDB search
MKLAAFALTLIPGIAIASSWTSPGFPTFSTQETGRFTSHAALTKGTRALTLHIDQQCWQP
SGAIKLNQMLSLKPCEGAPPQWRLFKDGDYTITVDTRSGTPTLLLSIKTEPERTAQLAYQ
CPVWDGSPLTLDVRQTFPEGTVVRDYYSGQTDTVQNGQITLQPADSHGLLLLERAETHAP
APFNWRNATVYFVLTDRFRNGDPTNDHSYSRHKDGMQEIGTFHGGDLRGLTSQLDYLQQL
GVNALWISSPFEQIHGWVGGGTKGDFPHYAYHGYYTQDWTTLDANMGSEADLRALVDGAH
QRGIRILFDVVMNHAGYATLADMQEYQFGALYLSGAERQKILGDRWTNWRPAAGQSWHSF
NDYINFSDSAAWEKWWGKKWIRTDIGDYDSPGFDDLTLSLAFLPDIKTESTTPSGLPAFY
ANKPDTKAKFIEGYTPRDYLTHWLSQWVHDYGIDGFRVDTAKNVELPAWQQLKTQASAAL
REWKQANPDKALDNSPFWMTGEAWGHGVMKSDYYRYGFDAMINFDYQEQAAKAVDCLAEM
GPVWQQMTDKMQDFNVLSYLSSHDTRLFREGGDKAAELLLLSPGAVQIFYGDESARPFGP
TGSDPLQGTRSDMNWQDVSGKSAAAVAHWQRISQFRARHPAIGAGQQTTLTLKHGYGFVR
QYGDDTVMVVWAGRR
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttgccgccttcgctctgacgctgatacccggtatcgcgatcgcctcatcatgg
acctcacccggttttccgacgttctcgacgcaggaaaccgggcgctttaccagccatgct
gcattaacaaaaggtacacgcgcgttaacgctccatattgaccagcagtgctggcagccc
tccggcgccataaaactcaaccaaatgttgtcgttaaaaccctgcgaaggcgcgccgccg
caatggcgtttgtttaaagatggcgactatacgataacggtagatacccgctccggtacg
ccgaccctgttgttatcgataaaaactgaacctgaacgcaccgcgcagctcgcctaccag
tgtcccgtctgggatgggtcgccgctcacgctggatgttcgccaaacctttccggaaggg
acggtagtgcgcgattattacagtggtcaaaccgataccgtccaaaacgggcaaatcacg
ctgcaacctgcagacagccacgggcttttattgctggaacgcgcggaaacccatgcgccg
gcgccttttaactggcgcaacgccaccgtttattttgtgcttacggatcgctttcgcaat
ggcgatccaaccaacgaccacagctatagtcgccataaggatggtatgcaagagattggc
actttccacggcggcgatttgcgcgggttgacgagtcaactggactatctacagcaatta
ggcgtgaacgccttgtggataagctcgccgtttgaacagatccacggctgggtcggcggc
gggacaaaaggcgattttcctcattacgcctatcacggctattacactcaggactggacg
acgctggatgccaatatgggcagcgaagccgatctccgcgcgctggtcgacggcgcgcac
cagcgcggcatccgtattttatttgacgtagtaatgaatcatgccggttacgccacgctg
gcggatatgcaggagtatcagttcggcgcgctctatttatccggcgcggaacggcaaaaa
attctcggcgatcgctggacaaactggcgacccgccgccggacaaagctggcacagcttt
aacgactacatcaacttcagcgacagcgccgcctgggaaaaatggtgggggaaaaagtgg
attcgtaccgatattggcgactacgacagtccgggatttgacgatttaaccctgtcgctg
gccttcctgccggatataaaaacggaatctaccacgccttccggtctacccgcgttctat
gccaacaaacccgatactaaagcaaagttcattgagggctatacgccacgggattatctg
actcactggttaagccagtgggtacatgattacggcattgacgggttccgggtcgatact
gccaaaaacgttgagcttcctgcctggcaacagctaaaaacccaggccagcgcggcgtta
cgtgaatggaagcaggccaatccggacaaagcgctggataatagcccgttctggatgact
ggcgaagcgtggggccacggcgtcatgaaaagtgattattatcgctatggtttcgacgcg
atgatcaattttgattatcaggagcaggcggcgaaagcggtcgattgcctggcggaaatg
gggccagtctggcagcagatgacggataaaatgcaggatttcaacgtattaagttacctc
tcctcgcatgatacgcgccttttccgtgagggcggtgataaggcggcggaactgctgctg
ctttcgccaggcgcggtgcagatcttttacggcgatgaatccgctcgtcccttcggcccc
accggctccgacccgctgcaaggcacccgttcagatatgaactggcaggacgtgagcgga
aagtcagccgcagccgtcgcgcactggcagcgtattagccagttccgcgccagacatccc
gccatcggcgcaggccaacaaaccacgctgacgctaaaacacgggtacggttttgtacgc
cagtacggcgacgatacggtgatggtcgtctgggcgggccgccgctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system