KEGG   Salmonella enterica subsp. enterica serovar Agona 24249: Q786_01005Help
Entry
Q786_01005        CDS       T02944                                 

Gene name
mrcB
Definition
bifunctional glycosyl transferase/transpeptidase
Orthology
K05365  
penicillin-binding protein 1B [EC:2.4.1.129 3.4.-.-]
Organism
sens  Salmonella enterica subsp. enterica serovar Agona 24249
Pathway
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:sens00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Q786_01005 (mrcB)
Enzymes [BR:sens01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     Q786_01005 (mrcB)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     Q786_01005 (mrcB)
Glycosyltransferases [BR:sens01003]
 Polysaccharide
  Bacterial polysaccharide
   Q786_01005 (mrcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
230620..233142
Genome map
AA seq 840 aa AA seqDB search
MAGNDREPIGRKGKPSRPVKQKVSRRRQHDDDYDDDYEDEEPMPRKGKGKGRKPRGKRGW
LWLLLKLFIVFVVLFAIYGVYLDQKIRSRIDGKVWQLPAAVYGRMVNLEPDMPVSKNEMV
KLLEATQYRLVTKMTRPGEFTVQANSIEMIRRPFDFPDSKEGQVRARLTFSDGRLETIVN
LDNNRQFGFFRLDPRLITMLSSPNGEQRLFVPRSGFPDLLVDTLLATEDRHFYEHDGISL
YSIGRAVLANLTAGRTVQGASTLTQQLVKNLFLSSERSYWRKANEAYMALIMDARYSKDR
ILELYMNEVYLGQSGDNEIRGFPLASLYYFGRPVEELSLDQQALLVGMVKGASIYNPWRN
PKLALERRNLVLRLLQQQKIIDQELYDMLSARPLGVQPRGGVISPQPAFMQMVRQELQAK
LGDKIKDLSGVKIFTTFDSVAQDAAEKAVVEGIPALKKQRKLSDLETAMVVVDRFSGEVR
AMVGGAEPQYAGYNRAMQARRSIGSLAKPATYLTALSQPNLYRLNTWIADAPISLRQPNG
QVWSPQNDDRRYSESGKVMLVDALTRSMNVPTVNLGMALGLPAVTDTWTKLGVPKDQLNP
VPAMLLGALNLTPIEVAQAFQTIASGGNRAPLSALRSVIAEDGKVLYQSYPQAERAVPAQ
AAYLTLWTMQQVVQRGTGRQLGAKYPGLHLAGKTGTTNNNVDTWFAGIDGSQVTITWVGR
DNNQPTKLYGASGAMAIYQRYLANQTPTPLVLTPPEDVVDMGVDYDGNFVCSGGMRTLPV
WTDDPNTLCQQGEMMQQQQQPSGNPFDQSSQPQQPAQQQPPKEEKSDGVAGWIKEMFGGN
NT seq 2523 nt NT seq  +upstreamnt  +downstreamnt
atggcggggaatgaccgcgagccgattggacgtaaggggaaaccgtcacgtcctgtgaaa
caaaaggtgagccgtcgtcggcagcatgacgacgattatgatgatgactatgaggatgaa
gaaccgatgccgcgtaaaggtaagggcaaagggcgtaagcctcgtggcaagcgcggctgg
ctgtggctattgctaaaactgtttatcgtttttgtggtgctgttcgccatttacggcgtc
tatctggatcaaaaaatccgcagccgtattgatggcaaggtctggcagcttccggcggcg
gtatatggtcggatggtgaaccttgagccagacatgcctgtcagcaaaaacgagatggtg
aaattgctggaagcgacgcagtatcgtctggtgacgaagatgacccgtcccggcgaattt
accgtgcaggccaatagcattgagatgatccgtcgtccgtttgacttcccggacagcaaa
gaagggcaggtgcgcgcacggctgacgttcagtgacgggcgtctggaaaccatcgtcaat
ctggataacaaccgccagtttggcttcttccgcctcgatccgcggcttatcactatgctt
tcttcgccaaatggcgagcagcgtttattcgtcccgcgcagcggtttcccggatctgctg
gtcgatacgctgttggcgacggaagaccgtcatttctatgagcatgatggcattagtctt
tactctatcgggcgtgcggtgctggccaacctgacggcgggacgcacggtgcagggggcc
agtacgctgacccagcagctggtgaagaacctgttcctctccagcgaaagatcatactgg
cgtaaagcgaatgaagcctacatggcgctgatcatggatgcccgttacagtaaagatcgt
attcttgagctgtacatgaacgaggtctacctcggtcaaagcggggataatgaaattcgc
ggttttcctctggcgagcctgtattactttggtcgtccggtagaggaactgagcctcgat
cagcaggcgttactggtggggatggtaaaaggggcgtcgatttataacccgtggcgcaac
ccgaaactggcgctggagcgtcgtaacctggtgctacgcctgttacagcagcagaaaatc
atcgatcaggaactctatgacatgctgagcgcgcgtccgcttggcgtacagccgcgcggc
ggcgttatttcaccgcagccagcgtttatgcagatggttcgtcaggaactgcaggcgaag
ctgggggataaaattaaagatctctccggcgtgaagatcttcaccacctttgactccgtg
gcgcaggatgccgcagaaaaagccgttgtcgaaggcattccggcgttgaagaagcagcgt
aaattgagcgatctggaaaccgcgatggtggtagtggatcgctttagcggcgaggtgcgc
gcgatggttggcggggcggagccgcagtatgccggctataaccgtgccatgcaggcgcgc
cgttccatcgggtcgctggcgaaaccggcgacctatctgaccgcgttaagtcagccgaac
ttataccgtctgaacacctggattgccgatgcgccgatttcgctgcgccagccgaatggt
caggtctggtcgccgcagaacgacgatcgtcgctacagcgaaagcgggaaagtgatgctg
gtggatgcgttaactcgctcaatgaacgtaccgacggtcaatctggggatggcgttaggt
ttaccggcggtaaccgatacctggacgaagctcggcgtgccgaaagatcagctcaatccg
gttccggctatgctgttaggggcgctgaacctgacgccgatcgaagtggcgcaagcgttc
cagactatcgccagcggcggaaatcgcgcgccgttatcagcgctgcgttcggttattgcg
gaagatggtaaggtgctgtaccaaagttatccgcaagctgaacgcgccgtaccggcacag
gcggcttacctgacgctctggacaatgcagcaggtcgtccagcgtggtacggggcgtcag
cttggcgcgaaatatccgggtctgcatctggcgggtaaaaccgggacgacaaacaacaat
gtcgatacctggtttgccggtatcgacggcagccaggtgactatcacctgggtaggccgt
gataacaaccagccgacgaaattgtacggcgccagcggcgcgatggcgatttaccagcgc
tatctggcgaaccagacgccgacgcctttagttctgacgccgccggaagatgtggtggat
atgggcgttgattacgacggtaattttgtctgtagcggcggtatgcgcactctgccggtc
tggacggacgatccaaatacgctgtgccagcagggcgagatgatgcagcagcaacagcag
ccgtcaggcaatccgttcgatcagtcgtctcagccgcagcagcctgcgcagcaacagccg
ccgaaagaagagaagagcgacggcgttgctggctggattaaggagatgttcggcggcaat
taa

DBGET integrated database retrieval system