KEGG   Salmonella enterica subsp. enterica serovar Agona 24249: Q786_11500Help
Entry
Q786_11500        CDS       T02944                                 

Definition
(RefSeq) aminotransferase AlaT (EC:2.6.1.2)
  KO
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
sens  Salmonella enterica subsp. enterica serovar Agona 24249
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sens00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    Q786_11500
   01230 Biosynthesis of amino acids
    Q786_11500
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Q786_11500
   00290 Valine, leucine and isoleucine biosynthesis
    Q786_11500
   00220 Arginine biosynthesis
    Q786_11500
Enzymes [BR:sens01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     Q786_11500
    2.6.1.66  valine---pyruvate transaminase
     Q786_11500
Amino acid related enzymes [BR:sens01007]
 Aminotransferase (transaminase)
  Class I
   Q786_11500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
Position
2402604..2403818
Genome map
AA seq 404 aa AA seqDB search
MSPIEKSSKLENVCYDIRGPVLKEAKRLEEEGNKVLKLNIGNPAPFGFEAPDEILVDVIR
NLPTAQGYCDSKGLYSARKAIMQHYQARGMRDVTVEDIYIGNGVSELIVQAMQALLNSGD
EMLVPAPDYPLWTAAVSLSSGKAVHYLCDESSDWFPDLDDIRAKITPRTRGIVIINPNNP
TGAVYSKELLMEIVNIAREHNLIIFADEIYDKILYDDAEHHSIAALAPDLLTITFNGLSK
TYRVAGFRQGWMVLNGPKKHAKGYIEGLEMLASMRLCANVPAQHAIQTALGGYQSISEFI
LPGGRLYEQRNRAWELINDIPGVSCVKPRGALYMFPRIDAKRFNIHDDQKMVLDFLLQEK
VLLVQGTAFNWPWPDHFRIVTLPREDDLEMAINRFGRFLSGYHQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgtcccccattgaaaaatccagcaaactcgaaaatgtctgttatgacattcgtggcccc
gttctgaaagaagcgaaacgccttgaggaagaaggtaataaagttcttaaactgaatatc
ggcaaccccgcccccttcggattcgaagcgccggacgaaattctggtcgatgtcattcgt
aatttgccgacggcgcaaggatattgcgactcgaaagggctttattctgcccgtaaagcg
attatgcagcattatcaggcccgtggaatgcgcgatgtaaccgtggaagatatctatatc
ggtaacggcgtttccgagctgatcgttcaggcgatgcaggcgttgcttaacagtggcgat
gaaatgctggttcccgcgcccgattatccgttatggacagcggcggtatcgctctccagc
ggcaaggcggtacattatctttgcgatgaatcttccgactggttcccggaccttgacgat
atccgcgccaaaatcaccccacgtacgcgtggtattgtcattattaatccaaacaaccct
actggcgccgtctattctaaagaattgttgatggaaattgtcaacattgcgcgcgagcat
aatctcatcatcttcgccgatgaaatttatgacaagattctctatgacgatgccgagcat
cactctatcgccgcactggcacctgatctgctgaccatcacctttaatgggttgtctaaa
acctatcgcgtcgccggcttccgccagggctggatggtgctgaacgggccgaaaaaacat
gcgaagggctatattgaagggctggagatgttagcctcaatgcgcctgtgcgccaacgtc
ccggcgcaacatgctattcagaccgcgctcggcggctatcaaagcattagcgaatttatt
ctgccgggcggtcgactgtatgaacagcgtaaccgcgcctgggagttgattaacgatatc
cccggcgtttcctgcgtaaaaccgcgcggcgcgttgtacatgttccccaggatcgacgct
aaacgttttaatattcacgacgaccagaagatggtgctggacttcctgctacaggaaaag
gtgctgctggtgcaaggtaccgcctttaactggccgtggccggatcacttccgcattgtg
acgctaccgcgtgaagatgacctggagatggccatcaaccgttttgggcgtttcctctca
ggttaccatcaataa

DBGET integrated database retrieval system