KEGG   Salmonella enterica subsp. enterica serovar Agona 24249: Q786_13410Help
Entry
Q786_13410        CDS       T02944                                 

Definition
4-aminobutyrate aminotransferase (EC:2.6.1.19)
Orthology
K07250  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
sens  Salmonella enterica subsp. enterica serovar Agona 24249
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:sens00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:sens00650]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:sens00250]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:sens00280]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:sens00410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
2818349..2819632
Genome map
AA seq 427 aa AA seqDB search
MNTNNALMQRRHNAVPRGVGQIHPIFAERAENCRVWDVEGREYLDFAGGIAVLNTGHLHP
GIVSAVEAQLKKLSHTCFQVLAYEPYLALCERMNQKVPGDFAKKTLLVTTGSEAVENAVK
IARAATKRSGAIAFSGAYHGRTHYTLSLTGKVHPYSAGMGLMPGHVYRALYPCPLHNVSD
DDAIASIERIFKNDAAPEDIAAIIIEPVQGEGGFYAASPAFMQRLRALCDQHGIMLIADE
VQSGAGRTGTLFAMEQMGVAADITTFAKSIAGGFPLAGVTGRADVMDAIAPGGLGGTYAG
NPIACAAALAVLDIFEQENLLQKANTLGNTLRDGLMEIAETHREIGDVRGLGAMIAIELF
ENGDPGKPNAALTADIVARARDKGLILLSCGPYYNILRILVPLTIEASQIRQGLEIIARC
FDEAKQA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaataccaataacgctttaatgcagcgccgtcataacgccgttcctcgcggcgtgggg
cagattcacccgattttcgccgagcgggcggaaaattgtcgggtctgggatgtcgaaggc
cgtgagtatctcgatttcgcgggcggcattgccgtcctgaacactggtcatttacatccg
ggcattgtttcagcggtggaagcgcagctgaagaaattgtcgcatacctgttttcaggtg
ctggcctatgaaccgtacctggcgttgtgcgaacgcatgaaccagaaggtaccgggcgat
ttcgccaaaaaaacgttgctggtcacgaccggttcagaagcggttgaaaacgcggtgaaa
atcgcccgcgcggcgacaaaacgcagcggcgctatcgcgtttagcggcgcttaccacggt
cgtacccactacacgctctctctgaccgggaaagtacacccgtactctgctggtatggga
ttgatgccaggccatgtctaccgcgcgctttatccttgcccgctacacaacgtcagcgac
gacgacgcgatcgccagcattgaacgcatctttaaaaatgatgccgcgccggaagatatc
gccgccattattattgagccggtacagggcgaaggcggattttacgctgcctctcccgcg
tttatgcagcgactgcgcgcgctatgcgaccaacacggcattatgttgattgccgacgaa
gtgcaaagcggcgcgggccggaccggtacgctgttcgccatggaacagatgggcgttgcg
gcagatattaccacgtttgcgaaatcgatcgccggcggctttccgctggcaggcgttacc
ggccgggcagacgtgatggacgctatcgcgccgggcgggctgggcggcacctatgccgga
aacccgattgcctgcgccgccgcgctggcggtactggacattttcgagcaggaaaattta
ctgcaaaaggcgaatacgcttggcaacacgctgcgcgatggcctgatggagatagcggaa
acgcaccgtgagattggcgacgtgcgcggactgggcgccatgatcgccattgagttgttt
gaaaatggcgaccccggcaaaccgaacgcggctctgaccgccgacattgtggcccgcgcc
cgcgataaagggttaattctgctctcctgcggtccttactacaacatcttgcgcatcctc
gttccactcactattgaggcctcgcagattcggcaaggcctggagattatcgcccggtgc
tttgatgaggcgaaacaagcgtaa

DBGET integrated database retrieval system