KEGG   Salmonella enterica subsp. enterica serovar Agona 24249: Q786_14605Help
Entry
Q786_14605        CDS       T02944                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sens  Salmonella enterica subsp. enterica serovar Agona 24249
Pathway
sens00071  Fatty acid degradation
sens00280  Valine, leucine and isoleucine degradation
sens00310  Lysine degradation
sens00362  Benzoate degradation
sens00380  Tryptophan metabolism
sens00620  Pyruvate metabolism
sens00630  Glyoxylate and dicarboxylate metabolism
sens00640  Propanoate metabolism
sens00650  Butanoate metabolism
sens00900  Terpenoid backbone biosynthesis
sens01100  Metabolic pathways
sens01110  Biosynthesis of secondary metabolites
sens01120  Microbial metabolism in diverse environments
sens01130  Biosynthesis of antibiotics
sens01200  Carbon metabolism
sens01212  Fatty acid metabolism
sens02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sens00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Q786_14605
   00630 Glyoxylate and dicarboxylate metabolism
    Q786_14605
   00640 Propanoate metabolism
    Q786_14605
   00650 Butanoate metabolism
    Q786_14605
  Lipid metabolism
   00071 Fatty acid degradation
    Q786_14605
   00072 Synthesis and degradation of ketone bodies
    Q786_14605
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Q786_14605
   00310 Lysine degradation
    Q786_14605
   00380 Tryptophan metabolism
    Q786_14605
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Q786_14605
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Q786_14605
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Q786_14605
Enzymes [BR:sens01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Q786_14605
Exosome [BR:sens04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Q786_14605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AHB45561
Position
complement(3064041..3065219)
Genome map
AA seq 392 aa AA seqDB search
MKEVVIVGALRTPIGCFQGTLARHSAVELGSMVVKALIERTGVDANAIDEVILGQVLTAG
AGQNPARQSAIKGGLPTTVSAITINDVCGSGLKALHLATQAIQCGEADIVIAGGQENMSR
APHVLNDSRTGALPDADNLVDSLVHDGLWDAFNDYHIGVTAENLAREYGISRELQDAYAL
SSQQKARAAIDTGRFKDEIVPIVTQRNGQTAIVDTDEQPRADASAEGLALLHPAFDSLGS
VTAGNASSINDGAAAVMMMSEAKAQALGLPVLARIRAFASVGVDPALMGIAPVYATRRCL
ERAGWQLTEVDLIEANEAFAAQALSVGKMLEWDERRVNVNGGAIALGHPIGASGCRILVS
LVHEMVKRDARKGLATLCIGGGQGVALTIERD
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaggttgtgatagtgggggctttacggacacccatcggctgttttcagggaacg
ctggcccgtcattccgccgtcgagctggggagcatggtcgtaaaagcgttaattgagcgc
accggcgtggacgctaacgctatcgatgaggtcatcctcggtcaggtactgacggctggc
gccgggcagaatccggcgcgccagtcagccatcaaaggagggctgccgactaccgtttcc
gccattaccattaatgacgtttgtggttccggtttaaaagcgttgcacctggcgacgcag
gctattcagtgcggcgaagcggacattgttatcgcgggcgggcaggagaatatgagccgt
gcgccgcatgtcctcaatgacagccgtaccggcgcgttgcctgatgccgacaatctggtg
gatagtctggtacatgatggcttatgggatgccttcaacgattatcacattggcgtgacg
gcagaaaacctggcgcgggaatatggcatcagccgcgagttacaggatgcttatgcgctc
agttcgcagcaaaaagccagggccgcgattgataccgggcgttttaaagatgagattgtc
cccatcgtcacgcaacgtaatgggcagaccgcaattgtcgatacggatgaacaaccgcgg
gccgacgccagtgcggaggggttagccctgctgcatccggcgtttgatagtttaggttcg
gtgacggcgggtaatgcctcctcaatcaacgatggcgccgccgcggtgatgatgatgagc
gaggcgaaagcccaggcgctggggctgccggtgctggcgcgcatccgcgcgtttgccagc
gtcggcgtcgatcctgcgctaatggggattgcgccggtatatgctacccggcgctgtctg
gagcgtgccggctggcaactgacggaggtcgaccttatcgaagccaacgaagcgtttgcc
gcccaggcgttgtcggtaggaaaaatgctggaatgggatgagcgacgggtaaacgttaat
ggcggcgcgattgcgctggggcatcctattggcgcttccggttgtcgaattctggtttca
ctggtgcacgaaatggttaaacgcgacgcgcgaaaaggtctggcgacgctgtgtatcggt
ggcggccagggcgttgctttaaccattgaacgcgactga

DBGET integrated database retrieval system