KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty21a: TY21A_05525Help
Entry
TY21A_05525       CDS       T02648                                 

Definition
glutamate dehydrogenase
Orthology
K00261  
glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
sent  Salmonella enterica subsp. enterica serovar Typhi Ty21a
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Nitrogen metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sent00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    TY21A_05525
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TY21A_05525
   00330 Arginine and proline metabolism
    TY21A_05525
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    TY21A_05525
Enzymes [BR:sent01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.3  glutamate dehydrogenase [NAD(P)+]
     TY21A_05525
Exosome [BR:sent04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   TY21A_05525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1164673..1165842)
Genome map
AA seq 389 aa AA seqDB search
MDTLRHPKRALIVDIPVQMDDGTIRHFEGYRVQHNLSRGPGKGGVRYHPDVDLNEVMALS
AWMTIKCAALNLPYGGAKGGIRVDPFSLSEGELERLTRRYTSEIGIIIGPQKDIPAPDVG
TNGKVMAWMMDTYSMNHGTTVTGVVTGKPIHLGGSLGREKATGRGVFVSGLEAARRANIA
VEGARVAVQGFGNVGSEAARLFAGAGARVVAIQDHTATLFNATGIDMKALTAWQTEHKQI
AGFPGAETIASDAFWRLEMDILIPAALEGQITRQRAEALTCKLVLEGANGPTYPDADDVL
ASRGILVVPDVVCNAGGVTVSYFEWVQDMASFFWSEEEINARMDKIMTDAIVHVWEKAAE
KSCSLRTAAYIVACERILLARKDRGIYPG
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
gtggatactctgcgccacccaaaacgcgctctgatcgtcgatattccggtacaaatggat
gatggcactattcgtcatttcgaaggatatcgcgtgcagcacaacctctcccgaggtccg
ggtaaaggcggtgttcgctaccatcctgacgttgatctcaatgaagtgatggccctgtca
gcatggatgaccatcaaatgtgccgcgctgaatctgccgtacggcggcgccaaaggcggc
atccgcgtcgatccgttctcgctgtcggaaggtgaactggagcgtttgacccgccgctat
accagcgagatcggcattatcatcgggccgcagaaagatattcctgcgccggatgtcggc
accaacggtaaagtgatggcctggatgatggatacgtattccatgaatcatggcacgacg
gtcactggcgtcgtcaccggtaagcctatccatcttggcggttcgctgggtcgtgaaaag
gcgacggggcgcggcgttttcgtcagcgggctggaagccgcgcgtcgggcgaatatcgcc
gttgaaggcgctcgcgttgcggttcagggttttggtaacgtcggcagcgaagccgcgcgt
ctgtttgcaggcgctggcgcccgtgtcgtggcgattcaggatcataccgcgacgctgttt
aacgccaccggtattgacatgaaggcgctcacggcatggcagacagaacacaaacagata
gccggtttcccgggcgcggaaactatcgccagcgatgcgttctggcgtctggagatggat
attctgatcccggcggcgcttgaaggccagataactcgtcagcgcgcggaagccctgacg
tgtaagctggtgctggaaggggctaacggcccgacctatccggatgctgatgatgttctg
gccagccgtggtatccttgtggtgcctgacgtggtctgtaacgcaggcggcgtaaccgtc
agctacttcgaatgggtacaagatatggccagcttcttctggagcgaagaagagatcaac
gcgcgcatggacaaaatcatgaccgacgcgatcgtccatgtctgggagaaagcggctgag
aaatcctgttctctgcgcaccgcagcctatattgtcgcctgtgagcgcattctgctggcc
cgtaaagatcgcggtatctatccaggttaa

DBGET integrated database retrieval system