KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty21a: TY21A_07330Help
Entry
TY21A_07330       CDS       T02648                                 

Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
sent  Salmonella enterica subsp. enterica serovar Typhi Ty21a
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sent00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TY21A_07330
   00330 Arginine and proline metabolism
    TY21A_07330
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    TY21A_07330
Enzymes [BR:sent01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     TY21A_07330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1490913..1491827
Genome map
AA seq 304 aa AA seqDB search
MDNAILETILQRVRPLIGQGKVADYIPALASVEGSKLGIAICTVDGQHYQAGDAHERFSI
QSISKVLSLVMAMRHYPEEEIWQRVGKDPSGSPFNSLVQLEMEQGIPRNPFINAGALVVC
DMLQGRLSAPRQRMLEVARALCGVSDITYDATVARSEFEHSARNAAIAWLMKSFGNFHHD
VPTVLQNYFHYCALKMSCMELARTFVFLANQGEAFHLDEPVVTPMQARQINALMATSGMY
QNAGEFAWRVGLPAKSGVGGGIVAIVPHEMAIAVWSPELDPAGNSLAGIAALEQLTQTLG
RLVY
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggataatgcaattttagaaacgattttacagcgcgttcgccccctcattggccagggc
aaagtagctgactatattccggcattagcgtccgtcgagggttcaaagctgggaatagcg
atttgtaccgtggacgggcagcattatcaggcgggcgatgcgcacgaacgcttctctatt
cagtctatttcgaaagtgctcagtctggtgatggcgatgcgtcattatccggaagaggag
atctggcagcgtgtcggaaaagatccttccggctcgccgttcaattcgttggttcagtta
gagatggaacaaggcatcccgcgtaatccatttattaatgcgggcgcgctggtggtatgc
gacatgttgcaagggcggcttagcgcgccgcgtcagcggatgctggaagttgcgcgcgcg
ctttgcggcgtatcggatattacatatgacgctacggtcgcgcgctctgaatttgagcat
tccgcccgtaacgccgctattgcctggctgatgaaatcattcggtaattttcatcatgat
gtgcctaccgtgttgcaaaattacttccactactgtgcgttgaaaatgagctgcatggaa
ctggcgaggacgtttgtctttctggcgaatcagggcgaggcgtttcatctcgacgagccg
gtagttacccccatgcaggcccggcagattaatgcgctaatggcgaccagcggtatgtat
cagaatgccggcgagtttgcctggcgggtgggattgcccgctaaatccggcgtgggcggc
ggtattgtcgccattgtgccgcatgaaatggcgattgccgtctggagtccggagctggat
cctgcgggaaactctctggcaggtatcgccgcgcttgaacaattaacacaaacgttagga
cgtttggtatactga

DBGET integrated database retrieval system