KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty21a: TY21A_10680Help
Entry
TY21A_10680       CDS       T02648                                 

Definition
putative pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
sent  Salmonella enterica subsp. enterica serovar Typhi Ty21a
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:sent00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sent00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2164890..2166173
Genome map
AA seq 427 aa AA seqDB search
MNTLSVSRLALALAFGVTLSACSSTPPDQIPSDQTAPGTASRPILSANEAKNFVAARYFA
SLTPNTAPWSPSPITLPAQPDFVVGPAGTPGVTHTSIQAAIDAAMVKRTNKRQYIAIMPG
DYQGTVYVPAAPGSLTLYGTGEKPIDVKIGMAIDGEMSVADWRRAVNPGGKYMPGKPAWY
MFDNCQSKHAATIGVMCSAAFWSQNNGLQLQNLTIENTLGDSVDAGNHPAVALRTDGDKV
QINKVNILGRQNTFFVTNSGVQNRLQTDRQPRTLVTNSYIEGDVDMVSGRGAVVFDNTNF
QVVNSRTQQEAYVFAPATLSNIYYGFLAINSRFNASGDGVAQLGRSLDVDANTNGQVVIR
DSVINEGFNVAKPWADAVISKRPFAGNTGTVDDKDEVQRNLNDTNYNRMWEYNNRGVGSK
VVTEPKQ
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaatacattatcggtttcccgtctggcgctggcactggcttttggcgtgacgctgagc
gcctgtagctctacgccacccgatcagatcccttccgatcaaaccgcgcctggcaccgcc
tcgcgccccattctgtcggcaaatgaagcgaaaaacttcgttgctgcgcgctattttgcc
tccctgacgccgaataccgccccgtggtcgccgtcgccgattaccctgcccgcacagcct
gactttgtggtggggccggcaggtacgccaggcgttacgcacacctcgattcaggccgcg
atcgatgcggcaatggttaaacgcacgaacaaacgccagtacattgctattatgccgggc
gactatcaggggaccgtgtatgttcccgccgcgccgggaagtctgaccctgtacgggacc
ggtgaaaaaccgatcgatgtaaaaattgggatggcgattgatggtgaaatgagtgtcgct
gactggcgccgcgcagtgaatcccggcgggaaatatatgcctggtaaacccgcctggtat
atgttcgataactgccaaagcaaacacgccgcgacgatcggtgtaatgtgttctgccgcg
ttctggtcgcagaataacggtctgcagctacaaaatctgaccatcgagaacacgctgggc
gacagtgtcgatgccggaaaccatccggcggtggcgctgcgtaccgatggcgacaaagtc
cagattaacaaggtcaatatccttggccgccagaacaccttctttgtgaccaacagcggc
gtgcagaaccgtctgcaaaccgatcgccagccgcgtacgctggtgacgaacagctatatt
gaaggcgatgtggatatggtttccggacgcggcgccgtggtgttcgataacaccaacttc
caggtcgtcaactcccgcacacagcaggaagcctacgtcttcgccccggcgacgctgtcc
aatatttactatggctttttggcgatcaacagccgctttaacgcctccggcgatggcgtt
gcgcagcttggccgctcgctggatgtcgacgccaacaccaacggtcaggtcgtgatccgc
gacagcgtgattaacgagggcttcaacgttgccaaaccgtgggccgacgcggtcatctcg
aaacgtccgtttgctggaaatacgggaaccgtggatgacaaagacgaggtgcagcgtaat
ctgaacgacacgaactacaaccgcatgtgggaatacaacaaccgcggtgtaggcagtaaa
gtagtgacggaacctaagcagtaa

DBGET integrated database retrieval system