KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty21a: TY21A_16605Help
Entry
TY21A_16605       CDS       T02648                                 

Definition
(RefSeq) malate dehydrogenase (EC:1.1.1.37)
  KO
K00024  
malate dehydrogenase [EC:1.1.1.37]
Organism
sent  Salmonella enterica subsp. enterica serovar Typhi Ty21a
Pathway
Citrate cycle (TCA cycle)
Cysteine and methionine metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Glyoxylate cycle
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sent00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TY21A_16605
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TY21A_16605
   00620 Pyruvate metabolism
    TY21A_16605
   00630 Glyoxylate and dicarboxylate metabolism
    TY21A_16605
  Energy metabolism
   00680 Methane metabolism
    TY21A_16605
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    TY21A_16605
Enzymes [BR:sent01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     TY21A_16605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3365768..3366706)
Genome map
AA seq 312 aa AA seqDB search
MKVAVLGAAGGIGQALALLLKNQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG
EDATPALEGADVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQIAKTCPKACVGIITNP
VNTTVAIAAEVLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKLPTEVEVPVIGGHSGV
TILPLLSQIPGVSFTEQEAAELTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVR
ALQGEKGVVECAYVEGDGQYARFFSQPLLLGKNGVEERKSIGTLSTFEQHSLDAMLDTLK
KDIQLGEDFINK
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcgcagtcctcggcgctgctggtggtatcggtcaggcgctggcattactttta
aaaaaccaactgccttcaggttcagaactctccctgtacgacatcgctccagtgactccc
ggtgtggccgttgatttaagccacatccccaccgctgtaaaaatcaaaggtttctccggt
gaagacgcaaccccggcgcttgaaggcgctgacgtagtactgatttctgcgggtgtggcg
cgtaagccgggtatggaccgttccgacctgtttaacgttaacgccggcatcgtgaaaaac
ctggtgcagcagatcgctaaaacctgcccgaaagcgtgcgtgggcattatcaccaacccg
gtgaacaccaccgttgcgattgcggcggaagtgttgaaaaaagcaggcgtatacgacaaa
aacaaactgtttggcgttaccacgctggatatcatccgctctaatacctttgtcgcagag
ctgaaaggtaagctgccaacggaagttgaagttccggtgattggcgggcactccggcgtg
acgattctgccgctgctatcgcagattccaggcgtaagttttaccgaacaagaagcggcc
gagctgactaaacgtattcagaacgccggtactgaagtcgtcgaggcgaaagccggcggc
ggatcggcaaccctctctatgggccaggctgccgcgcgtttcggtctttctctggttcgc
gctctgcagggcgaaaaaggcgtggtggaatgcgcctatgtggaaggcgacggtcagtat
gcccgtttcttctctcagccgctgctgctgggtaaaaacggcgtagaagagcgtaaatcc
atcggcacactgagcactttcgagcaacattcgctggacgctatgctggatacgctgaaa
aaagatattcagttgggtgaagattttattaataaataa

DBGET integrated database retrieval system