KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty21a: TY21A_17325Help
Entry
TY21A_17325       CDS       T02648                                 

Definition
putative lysozyme protein R
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
sent  Salmonella enterica subsp. enterica serovar Typhi Ty21a
Brite
Enzymes [BR:sent01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     TY21A_17325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3519057..3519569
Genome map
AA seq 170 aa AA seqDB search
MNPSIVKRCLVGAVLAIAATLPGFQQLHTSVEGLKLIADYEGCRLQPYQCSAGVWTDGIG
NTSGVIPGKTITERQAAEGLISNVLRVERALERCVKQQPPQKVYDAAVSFAFNVGTGNAC
SSTLVKLLNQRRWADACRQLPRWVYVKGVFNQGLDNRRAREMAWCLQGAN
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgaatccatcaatcgttaaacgctgccttgtcggggccgtgctggctattgctgccacg
ctgccgggttttcagcagcttcacacctccgtggaggggctgaaactgattgccgattac
gaaggttgtcgtctgcagccgtatcagtgcagcgcgggtgtctggaccgacggcattggt
aatacgtcaggcgtcattcccggcaaaaccattacggagcgacaggcagcagaagggctg
atctccaacgtgctgcgtgtggagcgggcgctggaaaggtgtgtgaagcaacagccgccg
cagaaggtgtatgacgctgcggtgtcgtttgccttcaacgtgggaacgggcaatgcctgc
agttccacactggtgaaattactcaatcagcggcgctgggcggatgcgtgccgacagttg
ccgcgctgggtttatgtgaaaggtgtttttaatcaggggctggataaccgccgtgcgcgg
gagatggcctggtgcttacagggagcaaactga

DBGET integrated database retrieval system