KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty21a: TY21A_18375Help
Entry
TY21A_18375       CDS       T02648                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sent  Salmonella enterica subsp. enterica serovar Typhi Ty21a
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sent00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TY21A_18375
Enzymes [BR:sent01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     TY21A_18375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3738152..3739081)
Genome map
AA seq 309 aa AA seqDB search
MKTAGNLIVLGSINADHILNLESFPTPGETVTGSHYQVAFGGKGANQAVAAGRSGANIAF
IACTGDDDIGDSIRKQLVSDRIDIAPVSVIKGESTGVALIFVNGEGENVIGIHAGANAAL
SPALVDAQRERIAQADALLMQLESPLESVLAAAKIAHQHHTTVALNPAPARELPDELLAL
VDIITPNETEAEKLTGVRVKNDDDVAKAAQVLHDKGIRTVLITLGSRGVWASVNGEGRRV
PGFSVEAVDTIAAGDTFNGAFITAILEETPLPEAIRFAHAAAAIAVTRKGAQPSVPWREE
IEAFLHQQG
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccgcaggtaatctcatcgtccttggcagcattaatgccgatcatatccttaat
cttgagtccttccctaccccgggtgaaacggtaaccggtagccattatcaggtcgcgttt
ggcgggaaaggcgcgaatcaggcggttgctgcgggacgtagcggggcaaatattgcgttt
atcgcctgcacgggcgatgacgatattggcgacagtattcgtaaacaattagtcagcgat
cgtattgatatcgcgccagttagcgtcattaaaggcgagtctaccggggtagcgctgatt
ttcgttaatggcgaaggcgagaacgtcatcggtattcatgccggagcgaatgccgcgtta
tcgccggcgttggttgatgcgcaacgtgaacgtatcgcgcaggcggatgcgttactgatg
cagctggaatcgccgctggaaagcgtactggcggcggcgaaaatcgcccatcaacatcat
actactgttgcgcttaacccggcacctgcccgtgagttaccggatgaactgctggcgctg
gtggacatcatcacgccaaatgaaacggaagctgaaaagctgacgggcgtgcgtgtgaaa
aatgacgacgatgtcgcgaaagctgcgcaggttttacatgataaaggcattcgaaccgta
ttaattaccttaggaagccgtggcgtctgggccagcgtaaacggcgagggtcgccgcgtt
cctggatttagcgttgaggctgtcgataccattgccgccggagatacgtttaacggcgcc
tttatcaccgcgatactggaggagacgccgttgccggaagcgattcgctttgcccatgcc
gccgccgcgattgccgtaacgcgtaaaggcgcgcaaccttccgttccgtggcgcgaagag
atagaagcgtttttacatcagcaggggtaa

DBGET integrated database retrieval system