KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty21a: TY21A_19605Help
Entry
TY21A_19605       CDS       T02648                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
sent  Salmonella enterica subsp. enterica serovar Typhi Ty21a
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:sent00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:sent00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3985800..3987122
Genome map
AA seq 440 aa AA seqDB search
MQAYFDQLDRVRYEGPQSTNPLAFRHYNPDELVLGKRMEDHLRFAACYWHTFCWNGADMF
GVGAFNRPWQQPGEALELAKRKADVAFEFFHKLNVPFYCFHDVDVSPKGASLKEYKNNFA
QMVDVLAAKQEQSGVKLLWGTANCFTNPRYGAGAATNPDPEVFSCAATQVVTAMNATHKL
GGENYVLWGGREGYETLLNTDLRQEREQIGRFMQMVVEHKHKMGFQGTLLIEPKPQEPTK
HQYDYDVATVYGFLKQFGLEKEIKVNIEANHATLAGHSFHHEIATAIALGIFGSVDANRG
DAQLGWDTDQFPISVEENALVMYEILKAGGFTTGGLNFDAKVRRQSTDKYDLFYGHIGAM
DTMALSLKIAARMVEDGELDKRVAKRYAGWNGELGQQILKGQLSLGELAQYAEQHHLAPV
HQSGHQELLENLVNRYLFDK
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcttattttgaccaactcgatcgtgttcgctatgaaggccctcaatcgactaac
ccgctggcatttcgtcattacaatcccgacgagctggttttaggtaaacgtatggaagat
cacctgcgtttcgcggcctgttactggcataccttctgctggaacggcgcggatatgttt
ggcgtaggcgcgtttaatcgtccgtggcagcaaccgggcgaagcgctggagctggcgaaa
cgcaaagcggacgtggcgtttgaatttttccacaaactgaatgtgcctttttactgcttc
catgacgtggatgtgtcgccgaaaggcgcgtcgttgaaagaatataaaaacaacttcgcg
cagatggtggatgtgctggcggcgaaacaggagcagagcggcgtaaaactgctgtgggga
acggcgaactgctttaccaacccgcgctatggcgcaggcgccgccactaacccggacccg
gaagtctttagctgtgcagcgacgcaagtggttacggcaatgaacgccacgcataaactg
ggcggcgaaaattacgtactgtggggcggacgcgaaggttatgaaacgttgctgaatacc
gatctacgccaggaacgcgaacagattggccgctttatgcaaatggtggttgagcacaaa
cataaaatgggtttccagggcacgctgctgattgaaccgaaaccgcaggaaccgacaaaa
catcagtatgattatgacgttgcaacggtctatggcttcctcaaacagttcggcctggaa
aaagagatcaaagtgaacattgaggcgaaccacgccacgctggcgggccattcgttccac
catgaaatcgcaaccgctatcgcgctgggtatttttggctccgttgatgccaaccgcggc
gatgcgcaactgggctgggataccgatcagttcccgattagcgttgaagagaacgcgctg
gtgatgtacgaaatcctgaaagcgggcggattcacgacgggcggtctcaacttcgacgcc
aaagttcgtcgccagagcaccgataaatacgatctgttctacggtcatatcggcgcgatg
gatacgatggcgttgtcactgaaaatcgccgcgcgtatggtcgaagacggcgagttggat
aaacgcgtggcgaagcgctatgccggctggaatggcgagctggggcagcagattctgaaa
ggacaactctccttaggcgaactggcgcagtatgcggagcagcaccatctggcgccggta
catcaaagcggtcatcaggagctgttagaaaatctggttaaccgttatctgtttgataaa
taa

DBGET integrated database retrieval system