KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty21a: TY21A_21390Help
Entry
TY21A_21390       CDS       T02648                                 

Definition
alpha-galactosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
sent  Salmonella enterica subsp. enterica serovar Typhi Ty21a
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:sent00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    TY21A_21390
  Lipid metabolism
   00561 Glycerolipid metabolism
    TY21A_21390
   00600 Sphingolipid metabolism
    TY21A_21390
Enzymes [BR:sent01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     TY21A_21390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4372165..4373517
Genome map
AA seq 450 aa AA seqDB search
MTAPKITFIGAGSTIFVKNILGDVFHREALKSAHVALMDIDETRLEESHIVVRKLMDSAG
ASGRITCHTHQKAALQDADFVVVAFQIGGYEPCTVTDFEVCKRHGLEQTIADTLGPGGIM
RALRTIPHLWQICEDMTEVCPKATMLNYVNPMAMNTWAMYARYPHIKQVGLCHSVQGTAE
ELARDLNIDPASLRYRCVGINHMAFYLELERKTADGTYVNLYPELLAAYDAGQAPKPNIH
GNERCQNIVRYEMFKKLGYFVTESSEHFAEYTPWFIKPGREDLIARYKVPLDEYPKRCVE
QLANWHKELEEYKTAERIDIKPSREYASTIMNALWTGEPSVIYGNVRNEGLIDNLPQGSC
VEVACLVDANGIQPTKVGTIPSHLAAMMQTNINVQTLLTEAILTENRDRVYHAAMMDPHT
AAVLGIEEIYALVDDLIAAHGDWLPAWLRR
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgacggcacccaaaattacctttatcggcgcaggttctacgattttcgtcaaaaatatc
ctcggcgatgtgtttcaccgcgaggcgctaaagtcagcgcatgtcgccctgatggatatt
gacgaaacccggctggaagagtcgcacattgtggtacggaaactgatggactcagcgggc
gcttctggccggattacctgccatacccaccagaaagcggcgctacaggatgcggatttc
gtggtggtcgcctttcagattggcggctatgaaccctgcaccgtgaccgattttgaggtt
tgtaagcgtcatggcctggaacagacgatcgccgatacgctggggccgggcggcatcatg
cgcgcgctgcgaaccatcccgcatctgtggcagatttgcgaagacatgacggaagtctgt
ccgaaggccaccatgctcaattacgtcaacccgatggcgatgaatacctgggcgatgtat
gcccgctatccgcatatcaaacaggtcggcctgtgccattcggtacagggaacggcggaa
gaactggcgcgcgacttgaatatcgatcccgcctcgctgcgctaccgctgcgtcggcatt
aaccacatggcgttttacctggaactggagcgcaaaacggctgacgggacttatgtcaat
ctctatcctgaattgctggcggcttatgacgccggacaggcgccgaagcccaatattcac
ggcaatgaacgctgccagaacatcgtgcgctatgagatgttcaaaaagttgggctacttc
gtcacggagtcatcagagcattttgccgagtacacgccgtggtttattaaaccgggacgc
gaggatctgattgcgcgctacaaggtgccgctggatgaatatccgaaacgctgcgtagaa
caactggcgaactggcataaagagctggaggagtataaaaccgccgagcgtatcgacatc
aaaccgtcccgcgagtacgccagcaccattatgaacgctctgtggaccggcgagccgagc
gtgatttacggcaatgtgcgtaatgagggactgattgataacctgccgcagggaagctgc
gtcgaggtggcttgtctggtagatgccaacggcattcaaccgacgaaggtggggacgatc
ccttcccatctggcggcaatgatgcagaccaacatcaacgtgcaaacgctgttgaccgaa
gccatcctcacggaaaaccgcgatcgcgtgtatcacgcggcgatgatggaccctcatacc
gcggcggtgctgggtatcgaagaaatctatgcgttggttgacgatctgatcgccgcgcat
ggcgactggcttccggcctggttacgccgttaa

DBGET integrated database retrieval system