KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 14028S: STM14_0149Help
Entry
STM14_0149        CDS       T01714                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
seo  Salmonella enterica subsp. enterica serovar Typhimurium 14028S
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:seo00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:seo00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
144191..145678
Genome map
AA seq 495 aa AA seqDB search
MADRNLRDLLAPWVAGLPARELREMTLDSRVAAAGDLFVAVVGHQADGRRYIPQAIAQGV
AAIIAEAKDEASDGEIREMHGVPVVYLSQLNERLSALAGRFYHEPSENMRLVAVTGTNGK
TTTTQLLAQWSQLLGETSAVMGTVGNGLLGKVIPTENTTGSAVDVQHVLASLVAQGVTFG
AMEVSSHGLVQHRVAALKFAASVFTNLSRDHLDYHGDMAHYEAAKWMLYSTHHHGQAIVN
ADDEVGRRWLASLPDAVAVSMEGHINPNCHGRWLKAEAVEYHDRGATIRFASSWGEGEIE
SRLMGAFNVSNLLLALATLLALGYPLTDLLKTAARLQPVCGRMEVFTAPGKPTVVVDYAH
TPDALEKALQAARLHCAGKLWCVFGCGGDRDKGKRPLMGAIAEEFADIVVVTDDNPRTEE
PRAIINDILAGMLDAGQVRVMEGRAEAVTNAIMQAKDNDVVLIAGKGHEDYQIVGTQRLD
YSDRVTAARLLGVIA
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
gtggcagatcgtaatttgcgcgaccttcttgctccgtgggtggctggactacccgcgcga
gaactgcgagagatgacgctcgacagccgtgtggctgcggcgggcgatctctttgtggca
gtggtgggtcatcaggcggacgggcgtcgatatatcccgcaggcgatagcgcaaggcgta
gctgccattattgcagaggcgaaagacgaggcgagcgacggtgagattcgcgaaatgcac
ggcgtaccagtcgtctatctcagccagctcaatgagcgtttatctgcgctggcgggccgc
ttttaccatgagccatctgaaaacatgcgtctggtggcggtgaccggcaccaatggcaag
accaccaccacccaactactggcgcagtggagccagttgctcggcgaaaccagcgcagtg
atgggaacggtaggcaacggactgttgggtaaagtgatcccgacggagaacacaaccggt
tccgctgtggatgttcagcatgtgctggccagtctggttgcgcagggcgtgaccttcggc
gcgatggaagtctcttctcacggcctggtgcagcatcgcgtggcggcgttgaaatttgcc
gcctccgtgtttactaatttgagccgcgaccatctcgactatcatggcgatatggcgcat
tacgaggcggcaaaatggatgctttattccacccaccatcatggtcaggcaatcgtcaac
gccgatgatgaagttggacgccgctggctggcgtcgctacccgatgcggtcgcggtatca
atggaagggcatatcaaccctaactgtcacggtcgttggctgaaagcggaggcggtggag
taccacgaccgcggagcgacgattcgttttgcttcaagctggggtgaaggcgaaatcgaa
agccgcttgatgggcgcgtttaacgtcagcaacttactgctggcattggcgacgctactg
gcgctgggctatccgttaacggatttgctgaaaaccgccgcgcgtttgcagccggtttgc
gggcgtatggaagtgttcactgcgccaggcaaaccgacggtggtggtggattacgcgcac
acgccggatgcgctggaaaaagcgttgcaggcggcgcgtctgcattgcgccggaaaattg
tggtgcgtctttggctgtggcggggatcgtgacaaaggtaagcgcccactcatgggggcc
attgccgaagaattcgcggatatcgtcgtggtgactgacgataacccgcgtaccgaggag
ccgcgcgccattatcaacgatattctggccggaatgctggacgccgggcaggtcagggta
atggaaggccgcgctgaggcggtaaccaatgccattatgcaggcaaaagacaatgacgtc
gtgctgattgcaggtaaagggcacgaggattaccagattgtcggcacgcagcgtcttgat
tattcagaccgcgtgaccgcagcgcgtttgctgggggtgatcgcatga

DBGET integrated database retrieval system