KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 14028S: STM14_1050Help
Entry
STM14_1050        CDS       T01714                                 

Gene name
poxB
Definition
pyruvate dehydrogenase
Orthology
K00156  
pyruvate dehydrogenase (quinone) [EC:1.2.5.1]
Organism
seo  Salmonella enterica subsp. enterica serovar Typhimurium 14028S
Pathway
Pyruvate metabolism
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:seo00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(968436..970154)
Genome map
AA seq 572 aa AA seqDB search
MKQTVAAFIAKTLEQAGVKQIWGVTGDSLNGLSDSLNRMGTIEWMPTRHEEVAAFAAGAQ
AQLTGELAVCAGSCGPGNLHLINGLFDCHRNHVPVLAIAAHIPSSEIGSGYFQETHPQEL
FRECSHYCELVSSPEQIPQVLAIAMRKAVLNRGVSVVVLPGDVALKPAPENAVTHWYHAP
LPVVTPAEEELKKLAQLLRYSSNIALMCGSGCAGAHEELVALAAKLKAPIVHALRGKEHV
EYDNPYDVGMTGLIGFSSGFHTMMNADTLILLGTQFPYRAFYPSDAKIIQIDINPGSIGA
HSKVDMALVGDIKATLRALLPLVEEKSNRKFLDKALEHYRDARKGLDDLAKLSDKAIHPQ
YLAQQISHFAADDAIFTCDVGTPTVWAARYLKMNGKRRLLGSFNHGSMANAMPQALGAQA
TAPGRQVIAMCGDGGFSMLMGDFLSVVQMKLPIKIVVFNNSVLGFVAMEMKAGGYLTDGT
ELHDTNFARIAEACGITGIRVEKAADVDGALQRAFSIDGPVLVDVVVAKEELAIPPQIKL
EQAKGFSLYMLRAIISGRGDEVIELAKTNWLR
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaaccgttgctgcttttatcgccaaaacgctggaacaggctggcgtaaaacaa
atctggggcgtcactggcgactccctgaacggcctgagcgatagtcttaatcgtatggga
accattgaatggatgccaacccgccacgaagaggtcgccgctttcgccgccggcgcacaa
gcgcagcttaccggcgagctggcagtgtgcgccggttcatgtggaccgggcaacctgcac
ctgatcaatggcctgtttgattgccaccgtaaccacgtccctgttctggcgatcgccgcc
catattccgtccagtgaaatcggcagcggttatttccaggagacccacccgcaggagttg
ttccgtgaatgcagccactattgcgagttggtttccagcccggagcagatcccgcaggta
ctcgccatcgctatgcgcaaagcggtgttaaatcgcggcgtctccgtggtcgtactgccg
ggtgacgtggcgctgaaacccgcgcctgaaaacgccgtcacccattggtaccatgccccg
ctccccgtcgtcacgccggcggaggaagagctgaaaaaactggcgcaactgctgcgctac
tccagcaatatcgcattgatgtgcggtagcggctgcgcgggcgcgcatgaggagttggtc
gcgttggcggcaaaactaaaagcgccaatcgttcatgccctgcgcggcaaagagcacgtt
gagtacgataacccttatgatgtgggaatgaccggcctgattggcttctcttctggcttc
cacaccatgatgaacgccgatacgctgatcctgctcggcacccagttcccctatcgcgcc
ttttatccgagcgatgccaaaatcattcagattgacatcaacccgggcagtattggcgcg
cacagcaaagtcgacatggcgctagtgggcgatattaaagccacgcttcgcgccctgctg
ccgctggtggaagaaaaaagcaatcgtaaattcctcgataaagctctggagcactatcgg
gacgcccgtaagggacttgatgacttagccaaactcagcgataaagccatccacccacaa
tatctggcgcaacaaattagtcatttcgccgctgacgacgctatttttacctgcgatgtc
ggcacgccgaccgtctgggcggcccgctatctaaaaatgaacggcaagcgccgcctgcta
ggctcgtttaaccacgggtcaatggccaacgctatgccgcaggcgctcggcgctcaggct
accgcgccgggtcgtcaggttatcgcgatgtgcggtgatggcggcttcagtatgctgatg
ggcgattttctctcggtggtacagatgaagctgccgataaaaatcgtcgtctttaataac
agcgtgctgggctttgtggcgatggaaatgaaagccggcggctaccttaccgacggtacc
gaactgcacgacaccaatttcgcgcgtatcgccgaagcctgcggcattaccggtattcgc
gtggaaaaagccgcagacgtggacggtgcgctacagcgcgcgttttccattgacggcccg
gtactggttgacgtggtcgtggcaaaagaagagctggcgatcccgccgcagatcaaactg
gaacaagcgaaaggctttagcctgtacatgctacgcgccattattagcggccgcggcgat
gaagtgatcgaactggcgaaaacgaactggctaaggtaa

DBGET integrated database retrieval system