KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 14028S: STM14_1451Help
Entry
STM14_1451        CDS       T01714                                 

Definition
lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
seo  Salmonella enterica subsp. enterica serovar Typhimurium 14028S
Brite
Enzymes [BR:seo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     STM14_1451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1303335..1303874
Genome map
AA seq 179 aa AA seqDB search
MALRTKVKYGLSAAMLALIAAGASAPQLLDQFLQEREGNMLVAVRDNGGVWSVCRGVTRI
DGKPVVKGQRLTQSQCDHYNAIERDKALAWVNKNIHVPLTGPQKVGIASFCPYNIGPGKC
LPSTFYRKLNAGDRKGACAEIRRWVYDGGKDCHNRENQCYGQVIRRDQESALACWGIEQ
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggcgttaaggacaaaagttaaatacggtctttccgccgctatgctggcactgattgcc
gccggtgccagcgcaccgcagctactcgaccagtttttacaggagcgggaaggaaatatg
ctggtggccgttcgtgataacggcggcgtctggtcagtatgccgtggcgtgacccgtatc
gatggtaaacccgttgtgaaaggtcagcgactgacacaaagccagtgcgaccattacaac
gccatcgagcgggataaagcgctggcgtgggtcaataaaaatatccatgttccactgacc
gggccgcagaaagtggggatcgccagtttctgcccgtacaacattgggccgggtaaatgt
ctgccctccacgttctacagaaagctgaacgcaggagatcgtaagggagcgtgtgcagaa
atccgccgttgggtatatgacggcggcaaagactgccacaacagggaaaatcagtgttac
ggccaggtgatacgacgcgaccaggaatcggcgctggcgtgctggggtattgaacaataa

DBGET integrated database retrieval system