KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 14028S: STM14_2304Help
Entry
STM14_2304        CDS       T01714                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase motor protein
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
seo  Salmonella enterica subsp. enterica serovar Typhimurium 14028S
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:seo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    STM14_2304 (ruvA)
Enzymes [BR:seo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     STM14_2304 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2001478..2002089)
Genome map
AA seq 203 aa AA seqDB search
MIGRLRGIILEKQPPIVLLETGGVGYEVHMPMTCFYELPEAGQEAIVFTHFVVREDAQLL
YGFNNKQERTLFKELIKTNGVGPKLALAILSGMSAQQFVNAVEREELGALVKLPGIGKKT
AERLIVEMKDRFKGLHGDLFTPAVDLVLTSPASPTSEDAEQEAVAALVALGYKPQEASRM
VSKIARPDASSETLIRDALRAAL
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgataggcagactcagaggcattattctcgaaaaacaacccccgatcgtgctgctggag
acagggggcgtaggctatgaagtacatatgcctatgacctgcttttacgagctgccggag
gccgggcaggaggcaatcgtcttcacccacttcgtggtgcgtgaagatgcgcagttgctg
tacggatttaacaataagcaagagcgcacgctatttaaagagctaattaaaacgaatggc
gtcgggcctaagctggcgctggcgatcctctccggcatgtcggcgcaacagttcgtcaat
gcggttgagcgcgaagagcttggtgcgctggtgaagctgccgggtatcggcaagaaaact
gccgaacgattgattgtcgaaatgaaagaccgctttaaagggctacatggcgatctcttt
acgccagcggtcgatctggtattgacgtcgccggccagcccaacctcggaagatgcagaa
caagaagcagttgctgcgctggtggcgctgggttataaaccgcaagaagccagtcggatg
gtaagcaagatcgcccgtccggatgcaagcagtgaaacactgattcgcgacgcgttacgc
gccgcgttatga

DBGET integrated database retrieval system