KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 14028S: STM14_2304Help
Entry
STM14_2304        CDS       T01714                                 

Gene name
ruvA
Definition
(GenBank) Holliday junction DNA helicase motor protein
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
seo  Salmonella enterica subsp. enterica serovar Typhimurium 14028S
Pathway
seo03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:seo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    STM14_2304 (ruvA)
Enzymes [BR:seo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     STM14_2304 (ruvA)
DNA repair and recombination proteins [BR:seo03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     STM14_2304 (ruvA)
    RecFOR pathway proteins
     STM14_2304 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N HHH_5 RuvA_C HHH IMS_HHH Transposase_20 HHH_8 HHH_3 LcrG
Motif
Other DBs
NCBI-ProteinID: ACY88762
UniProt: A0A0F6B2M3
Position
complement(2001478..2002089)
Genome map
AA seq 203 aa AA seqDB search
MIGRLRGIILEKQPPIVLLETGGVGYEVHMPMTCFYELPEAGQEAIVFTHFVVREDAQLL
YGFNNKQERTLFKELIKTNGVGPKLALAILSGMSAQQFVNAVEREELGALVKLPGIGKKT
AERLIVEMKDRFKGLHGDLFTPAVDLVLTSPASPTSEDAEQEAVAALVALGYKPQEASRM
VSKIARPDASSETLIRDALRAAL
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgataggcagactcagaggcattattctcgaaaaacaacccccgatcgtgctgctggag
acagggggcgtaggctatgaagtacatatgcctatgacctgcttttacgagctgccggag
gccgggcaggaggcaatcgtcttcacccacttcgtggtgcgtgaagatgcgcagttgctg
tacggatttaacaataagcaagagcgcacgctatttaaagagctaattaaaacgaatggc
gtcgggcctaagctggcgctggcgatcctctccggcatgtcggcgcaacagttcgtcaat
gcggttgagcgcgaagagcttggtgcgctggtgaagctgccgggtatcggcaagaaaact
gccgaacgattgattgtcgaaatgaaagaccgctttaaagggctacatggcgatctcttt
acgccagcggtcgatctggtattgacgtcgccggccagcccaacctcggaagatgcagaa
caagaagcagttgctgcgctggtggcgctgggttataaaccgcaagaagccagtcggatg
gtaagcaagatcgcccgtccggatgcaagcagtgaaacactgattcgcgacgcgttacgc
gccgcgttatga

DBGET integrated database retrieval system