KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 14028S: STM14_2588Help
Entry
STM14_2588        CDS       T01714                                 

Gene name
rfbC
Definition
dTDP-4-deoxyrhamnose 3,5 epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
seo  Salmonella enterica subsp. enterica serovar Typhimurium 14028S
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:seo00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:seo00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Structure
PDB: 

Jmol
Position
complement(2226670..2227221)
Genome map
AA seq 183 aa AA seqDB search
MMIVIKTAIPDVLILEPKVFGDERGFFFESYNQQTFEELIGRKVTFVQDNHSKSKKNVLR
GLHFQRGENAQGKLVRCAVGEVFDVAVDIRKESPTFGQWVGVNLSAENKRQLWIPEGFAH
GFVTLSEYAEFLYKATNYYSPSSEGSILWNDEAIGIEWPFSQLPELSAKDAAAPLLDQAL
LTE
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
gtgatgattgtgattaaaacagcaataccagatgtcttgatcttagagcctaaagttttt
ggcgatgagaggggattcttttttgaaagttataaccagcagacctttgaagagttgatt
ggacgtaaagttacatttgttcaagataatcattcaaaatccaaaaagaacgtactcaga
gggctacattttcagagaggagaaaatgcacaggggaagttagttcgttgtgctgtcggt
gaggtttttgatgttgcggtcgatatccgaaaagaatcgcctacttttggtcaatgggtt
ggtgtaaatctgtctgctgagaataagcgacagctttggattccagaaggttttgctcat
ggttttgttactcttagtgagtatgcagagtttctgtacaaagcaactaattattactca
ccttcatcggaaggtagcattctatggaatgatgaggcaataggtattgaatggcctttt
tctcagctgcctgagctttcagcaaaagatgctgcagcacctttactggatcaagccttg
ttaacagagtaa

DBGET integrated database retrieval system