KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 14028S: STM14_2592Help
Entry
STM14_2592        CDS       T01714                                 

Gene name
galF
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase subunit GalF
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
seo  Salmonella enterica subsp. enterica serovar Typhimurium 14028S
Pathway
seo00040  Pentose and glucuronate interconversions
seo00052  Galactose metabolism
seo00500  Starch and sucrose metabolism
seo00520  Amino sugar and nucleotide sugar metabolism
seo01100  Metabolic pathways
seo01130  Biosynthesis of antibiotics
Module
seo_M00362  Nucleotide sugar biosynthesis, prokaryotes
seo_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:seo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    STM14_2592 (galF)
   00052 Galactose metabolism
    STM14_2592 (galF)
   00500 Starch and sucrose metabolism
    STM14_2592 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    STM14_2592 (galF)
Enzymes [BR:seo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     STM14_2592 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3 EFP_N
Motif
Other DBs
NCBI-ProteinID: ACY89037
UniProt: A0A0F6B3E7
Position
complement(2230509..2231531)
Genome map
AA seq 340 aa AA seqDB search
MLWCRLRRNVERAIIIPGSRVIHAGENKLKSYNSATILQVEETMMNLKAVIPVAGLGMHM
LPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEIVLVTHASKNAVENHFDTSYELESLL
EQRVKRQLLAEVQSICPPGVTIMNVRQAQPLGLGHSILCARPVVGDNPFIVVLPDIIIDD
ATADPLRYNLAAMVARFNETGRSQVLAKRMKGDLSEYSVIQTKEPLDNEGKVSRIVEFIE
KPDQPQTLDSDLMAVGRYVLSADIWAELERTEPGAWGRIQLTDAIAELAKKQSVDAMLMT
GDSYDCGKKMGYMQAFVKYGLRNLKEGAKFRKSIEQLLHE
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgttatggtgccgactaagacgtaatgtagagcgtgccatcattatccctggcagcaga
gtaattcatgctggcgaaaacaagctaaagagctataattcagcaaccattttacaggtg
gaagaaacaatgatgaatttgaaagcagttataccggtagcgggtttgggtatgcatatg
ttgcctgccaccaaggcaatcccaaaagagatgctaccgatcgtcgacaagccaatgatt
cagtacattgtcgatgagattgtggctgcagggatcaaagaaatcgtgctggtgactcac
gcgtctaaaaacgccgttgagaaccacttcgacacctcttatgaacttgaatcacttctt
gagcagcgcgttaagcgtcagcttttggcggaagtgcaatctatctgcccaccgggcgtg
acgattatgaacgttcgccaggcgcagccgttagggctggggcattctattctgtgcgcg
cgtccggtcgtgggcgataaccctttcattgtggtactcccggatattattatcgatgat
gctaccgccgatccgctgcgctataaccttgcggcgatggtggcgcgtttcaatgaaacg
ggtcgcagccaggtgctggcgaagcgcatgaaaggtgatttatcggagtattccgttatc
cagacgaaagaacctctggataatgaaggcaaagtcagccggattgtggagtttatcgaa
aaaccggatcagccgcagacgctggattccgatttgatggcggtaggccgttatgtgctt
tcagccgacatctgggcggaactggaaagaaccgaaccgggcgcctggggccgcatccag
ctcaccgatgccattgctgaactggcgaaaaaacagtcggttgacgcgatgctaatgacg
ggtgacagctatgactgcggtaaaaaaatgggctacatgcaggcatttgtgaagtacggg
ctgcgcaacctgaaagaaggagccaagttccgtaagagcatagagcagcttttgcatgaa
taa

DBGET integrated database retrieval system