KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 14028S: STM14_3046Help
Entry
STM14_3046        CDS       T01714                                 

Gene name
dapE
Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
seo  Salmonella enterica subsp. enterica serovar Typhimurium 14028S
Pathway
seo00300  Lysine biosynthesis
seo01100  Metabolic pathways
seo01120  Microbial metabolism in diverse environments
seo01230  Biosynthesis of amino acids
Module
seo_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:seo00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    STM14_3046 (dapE)
Enzymes [BR:seo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     STM14_3046 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Peptidase_M18
Motif
Other DBs
NCBI-ProteinID: ACY89478
UniProt: A0A0F6B4N7
Position
2649246..2650373
Genome map
AA seq 375 aa AA seqDB search
MSCPVIELTQQLIRRPSLSPDDAGCQALMIERLRKIGFTIEHMDFGDTQNFWAWRGRGET
LAFAGHTDVVPAGDVDRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERFVAQHPH
HRGRLAFLITSDEEASAKNGTVKVVEALMARNERLDYCLVGEPSSTEIVGDVVKNGRRGS
LTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDRGNDFFPATSMQVANIQAGT
GSNNVIPGELFVQFNFRFSTELTDEMIKERVHALLEKHQLRYTVDWWLSGQPFLTARGKL
VDAVVNAIEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIHKINECVNAADLQ
LLARMYQRIMEQLVA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtgcccggttattgagctgacacagcaacttattcgtcgcccctccctgagtccg
gatgacgcaggctgtcaggcattaatgattgaacgcctgcgtaaaatcggttttaccatt
gagcatatggattttggcgacacgcaaaatttttgggcatggcgtgggcgtggcgaaacg
ctggcgttcgccgggcatactgacgtcgtaccggctggcgatgtcgatcgctggatcaat
ccgccgtttgagcctacgattcgcgacggaatgttgttcggtcgcggcgcggcggatatg
aaaggttcactggcggccatggtggtggctgctgaacgttttgttgcgcagcatcctcat
caccggggccgcctcgcatttttgattacctctgatgaggaagccagcgcaaaaaatggc
accgtaaaggtggttgaagcgctgatggcccgtaacgagcggctggattactgtctggtc
ggcgaaccttccagtactgaaattgtgggcgatgtcgtcaaaaacgggcgtcgcggttct
ctcacctgtaacctcactatccatggcgttcaggggcacgtcgcctatccgcatctggcg
gataaccctgttcatcgcgccgcgccttttcttaatgaactggtcgctatcgagtgggat
cggggcaatgactttttcccggccaccagtatgcaggtagccaatatccaggcaggcacc
ggcagcaataatgtcattcccggcgaactgttcgtgcagtttaacttccgtttcagcacg
gaactgaccgatgagatgatcaaagagcgggtacatgcgctgcttgaaaagcatcagcta
cgctataccgtagactggtggctttccgggcagccgttcctgaccgcacgcggcaagctg
gtggacgcggtggtaaacgccattgagcactataatgaaattaaaccgcaattactgacg
acgggcggtacgtccgacggacgttttatcgcccgtatgggagcgcaggtggtagaactg
gggccggtgaacgccaccattcataaaattaatgaatgtgtgaatgccgccgatctccag
ctactggcccgtatgtatcaacgcattatggaacagctcgtcgcctga

DBGET integrated database retrieval system