KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 14028S: STM14_3529Help
Entry
STM14_3529        CDS       T01714                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
seo  Salmonella enterica subsp. enterica serovar Typhimurium 14028S
Brite
Enzymes [BR:seo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     STM14_3529 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3088095..3088721)
Genome map
AA seq 208 aa AA seqDB search
MVSGRVQALLEQLRAQGIRDEQVLNALAAVPREKFIDEAFEHKAWENIALPIGQGQTISQ
PYMVARMTELLELTPQSRVLEIGTGSGYQTAILAHLVHHVCSVERIKGLQWQARRRLKQL
DLHNVSTRHGDGWQGWQARAPFDAIIVTAAPPEIPTALMAQLDEGGILVLPVGDEQQFLK
RVRRRGGEFIIDTVEAVRFVPLVKGELA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggtaagtggacgtgtacaggctcttcttgaacaattgcgcgcgcagggcatcagagat
gagcaggtgcttaatgcgcttgctgcagtgccgcgcgagaaatttattgatgaagcgttt
gaacataaggcctgggaaaatatcgctttgccgataggccagggtcagacgatttcgcag
ccctatatggtggcgcgaatgacggagctgctcgaactgacgccgcaatccagggtgctg
gaaattggtaccggttccggctatcagacggcgattctggcgcatctggtacatcacgtt
tgctccgttgagcggattaaggggctgcaatggcaggcgcgtcgccgcctgaagcagctc
gatttacataatgtttctacccgtcatggcgatggctggcaaggctggcaggcgcgtgcg
ccatttgacgctatcattgtgacggccgcgccgccggaaattcctaccgcgctcatggca
cagttggatgaaggcggcattcttgttctgcccgtgggcgatgagcagcagtttttgaaa
cgcgtgcgtcgccggggcggcgaatttattatcgataccgtggaggccgttcgcttcgtc
ccgttagtcaagggagagctggcctag

DBGET integrated database retrieval system