KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 14028S: STM14_3587Help
Entry
STM14_3587        CDS       T01714                                 

Gene name
fucA
Definition
L-fuculose phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
seo  Salmonella enterica subsp. enterica serovar Typhimurium 14028S
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:seo00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    STM14_3587 (fucA)
Enzymes [BR:seo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     STM14_3587 (fucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3145479..3146126)
Genome map
AA seq 215 aa AA seqDB search
MERNRLARQIIDTCLEMTRLGLNQGTAGNVSVRYQGGLLITPTGIPYEKLTESHIVFIDA
DGQHEQGKLPSSEWRFHMAAYQTRPDANAVVHNHAVHCTAVSILNRPIPAIHYMIAAAGG
NSIPCAPYATFGTRELSDHVAVALKNRKATLLQHHGLIACEENLDKALWLAHEVEVLAQL
YLSTLAIVDPVPVLDDEAIAIVLEKFKTYGLRIEE
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggaacgaaatagactggcgcggcagattattgatacctgtctggaaatgacgcggtta
gggttaaatcaggggacggcaggtaacgtgagcgtacgttatcagggcggattgctgatt
acgccgacggggatcccctacgagaagctgacagagtcgcacattgtctttattgatgct
gacggtcagcatgagcagggcaagctgccttccagcgagtggcgttttcatatggcggca
taccagacgcgccctgacgccaatgccgtggtacataaccacgctgtccattgtacggca
gtctcgatcctgaatcgcccgattccggcgattcactacatgattgccgccgcaggagga
aactctattccctgcgcgccctacgccacttttggcacccgcgaactttctgaccatgtt
gccgtggcgcttaaaaatcgtaaagcgacgctgttacagcatcacgggcttatcgcttgt
gaagaaaatttagacaaagcgttgtggctggcgcatgaagtggaagtgctggcgcagctc
tatttaagtacgctggccattgtcgatccggtaccggtactggatgacgaggcgatcgct
atcgtactggagaaatttaaaacttacggattacgtattgaagagtga

DBGET integrated database retrieval system