KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 14028S: STM14_3675Help
Entry
STM14_3675        CDS       T01714                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
seo  Salmonella enterica subsp. enterica serovar Typhimurium 14028S
Brite
Enzymes [BR:seo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     STM14_3675 (dsbC)
Secretion system [BR:seo02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   STM14_3675 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Structure
PDB: 

Jmol
Position
complement(3222827..3223540)
Genome map
AA seq 237 aa AA seqDB search
MKKRFMMFTLLAAVFSGVAHADDAAIRQSLAKLGVQSTEIQASPVAGMKTVLTHSGVLYV
TDDGKHIIQGPMYDVSGAHPVNVTNKLLMSQLNALEKEMIVYKAPDEKHVITVFTDITCG
YCHKLHEEMKDYNALGITVRYLAFPRQGLESQAEQDMKSIWCAKDKNKAFDDAMAGKGVK
PASCDVNIADHYALGVQLGVSGTPAIVLSNGYVVPGYQGPKEMKAFLDEHQKQTSGK
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagcgttttatgatgttcactttactggcggcggtgttttcaggcgtggcccat
gcggatgatgcggctatccgtcagtcgctggctaagctgggcgttcagagtacggaaatt
caggcctcgccagtggcagggatgaaaaccgtcctcactcacagcggcgtactgtacgtc
actgatgacggcaaacatattattcaagggccgatgtatgacgtgagcggcgcgcatccg
gtaaacgtgacgaacaaactgctgatgagccagctaaatgcgctggaaaaagagatgatc
gtctataaagcgccggatgagaaacatgtcattactgtttttaccgatatcacctgcggc
tattgtcataagctacatgaagagatgaaagattataacgcgctggggatcacggtacgt
tatctggcttttccgcgccaggggctggaaagccaggcggagcaggatatgaaatctatc
tggtgcgccaaagacaaaaacaaagcgtttgatgacgccatggcaggtaagggcgtgaaa
ccggcaagctgtgacgtgaacattgctgatcattatgcgttgggcgtgcagttgggcgtt
agcggtacgccagccattgtattgagtaacggctatgtggtgcctggctatcagggaccg
aaagagatgaaagcgtttcttgatgagcatcaaaaacagaccagtggtaaataa

DBGET integrated database retrieval system