KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 14028S: STM14_4505Help
Entry
STM14_4505        CDS       T01714                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
seo  Salmonella enterica subsp. enterica serovar Typhimurium 14028S
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:seo00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3946790..3947413
Genome map
AA seq 207 aa AA seqDB search
MAQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRAPRPGEVHGEHYFFVNHD
EFKTMIGREAFLEHAEVFGNYYGTSRETIEQVLATGVDVFLDIDWQGAQQIREKMPQARS
IFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYDYLIVNDDFDTALSDLK
TIIRAERLRMSRQKQRHNALISKLLAD
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaggtacgctttatattgtttctgcccccagtggcgcgggtaaatccagcctg
attcaggctttattaaaaacccaaccgttgtatgacactcaggtttccgtttcacatacc
acgcgcgcgccgcgtccgggtgaagtgcacggtgagcactatttctttgtaaatcatgat
gagtttaaaaccatgattggcagggaggcgtttctggagcacgcggaagtgtttggcaat
tactacggcacttcgcgcgaaaccattgagcaagtgctggcaaccggcgttgatgttttt
ctggatatcgactggcagggcgcccagcaaattcgcgaaaagatgccgcaagcacgcagc
atttttattttgccgccgtcaaagatcgaattggatcgccgtttacgcggccgcgggcaa
gatagcgaagaagtcattgccaaacgaatggcgcaagcggttgcagaaatgagccattac
gccgaatatgattatcttattgtgaatgacgactttgataccgcgttaagcgacttgaaa
accatcattcgcgctgaacgtctgcgtatgagccgccaaaagcagcgtcataacgcttta
atcagcaaattgttggcagactga

DBGET integrated database retrieval system