KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 14028S: STM14_4764Help
Entry
STM14_4764        CDS       T01714                                 

Gene name
pldB
Definition
lysophospholipase L2
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
seo  Salmonella enterica subsp. enterica serovar Typhimurium 14028S
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:seo00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4179455..4180567
Genome map
AA seq 370 aa AA seqDB search
MSVFVPQYATAAVLCQARRKKRFYLVNEAENPMFQQQNDWETRENAFAAFAMGPLTDFWR
QREEAEFIGVGNIPVRFVRFRNDSNDRTIVICPGRIESYVKYAELAYDLFHLGFDIFIID
HRGQGRSGRMLSDPHRGHVDHFNDYVEDLAAFWQQEIEPGPWRKRYILAHSMGGAIATLF
LQRHRVRCDAIALTAPMFGIVIRLPSFMVRHILDWAEGHQRIREDYAIGTGQWRALPFGM
NALTHSRQRYQRNLRFYADEPQLRVGGPTWHWVREGILAGEQVLAGASDDTTPTLLIQAE
EERVVDNRTHDRFCEIRAAAGYPCEGGKPLVIKGAYHEILFEKDAMRSVALNAIVEFFNK
PNLSSGNRFA
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
ttgtctgtttttgtgccacaatacgctactgccgctgtgttgtgtcaggcacgacgcaaa
aaacgattttacctggtaaacgaggccgaaaacccgatgtttcagcagcaaaatgactgg
gaaacaagagaaaatgcgtttgccgcttttgctatggggccgctgaccgatttctggcgt
cagcgggaagaggcggagtttatcggcgtgggtaacattccggtgcgctttgtccgtttt
cgaaatgattccaacgatcggacgatcgtcatttgtcctggccgcattgagagttatgta
aaatacgctgaactggcgtatgacctttttcatctcggttttgatatcttcatcatcgac
caccgtggtcaagggcgctccgggcggatgttatcggacccgcatcggggtcatgtcgat
cattttaacgattatgttgaggacttagcggcgttctggcagcaggaaattgagccgggg
ccgtggcgtaagcgttatatcctggcgcactcaatggggggcgcgatagccaccctgttc
ctgcaacgccatcgtgtgcggtgcgacgctattgcgctcaccgcgccgatgtttggtatt
gtgatacgcttgccttcctttatggtgcgccatattctcgactgggccgaagggcaccag
cgtatccgtgaagattacgctattggtaccggtcagtggcgggcgttgccgtttgggatg
aatgcgctgacccacagccgccagcgttatcagcgcaacttacgattttatgccgacgag
ccgcagctgcgcgttggcggccccacctggcattgggtacgcgaaggcattctggcgggt
gagcaggtactggctggggcgagcgatgacacgacgcctacgctactgattcaggcggaa
gaagagcgggtagtggataaccgcacccacgatcgtttttgtgaaattcgcgccgcggcg
ggatacccttgtgaagggggaaaaccgctggttatcaaaggcgcgtaccatgagatcctt
tttgaaaaggacgccatgcgctcagtcgcgcttaacgccattgttgaatttttcaacaag
cctaatttatccagcggaaatcgctttgcttag

DBGET integrated database retrieval system