KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 14028S: STM14_5488Help
Entry
STM14_5488        CDS       T01714                                 

Gene name
deoA
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
seo  Salmonella enterica subsp. enterica serovar Typhimurium 14028S
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:seo00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    STM14_5488 (deoA)
Enzymes [BR:seo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     STM14_5488 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4835059..4836489
Genome map
AA seq 476 aa AA seqDB search
MALRLSGLQIQACRPDKALAAIRRCKPSTLFPQEGTVFLAQEIIRKKRDGHALSDEEIRF
FINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLTMAMRDSGTVLDWKSLNLNGPIVDK
HSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHTGGTLDKLEAIPGFDIFPDDNRFRE
IIQDVGVAIIGQTSSLAPADKRFYATRDITATVDSIPLITGSILAKKLAEGLDALVMDVK
VGSGAFMPTYELSEALAEAIVGVANGAGVRTTALLTDMNQVLASSAGNAVEVREAVQFLT
GEYRNPRLFDVTMALCVEMLISGQLAKDDAEARAKLQAVLDNGKAAEVFGRMVAAQKGPS
DFVENYDKYLPTAMLSKAVYADTEGFISAMDTRALGMAVVSMGGGRRQASDTIDYSVGFT
DMARLGDSIDGQRPLAVIHAKDEASWQEAAKAVKAAIILDDKAPASTPSVYRRITE
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgcgcttatccggcctacaaatccaggcctgtaggccggataaggcgttagcc
gccatccggcgatgtaagccttctactcttttccctcaggagggtaccgtgtttctcgca
caagaaattattcgtaaaaagcgtgatggtcatgcgttgagtgacgaagaaattcgtttc
tttattaatggtattcgtgacaatactatctctgaagggcagattgccgccctggcgatg
accatcttcttccacgatatgaccatgccggagcgtgtttcgctgaccatggcgatgcgg
gattccggtactgtccttgactggaaaagcctgaatctcaatggcccgattgtcgataag
cattcgaccggcggcgtaggggacgtgacgtctctgatgttggggccaatggtagcggcc
tgcggcggttatgtgccgatgatctccggtcgcggcctcggacataccggcggtacgctc
gacaaactggaagcgatcccgggcttcgatatcttcccggacgacaaccgtttccgcgaa
attattcaagacgtgggtgtggcgattattgggcaaaccagctcgcttgcaccggcggac
aaacgtttttacgccacccgcgatattaccgcgacggtggactctattccgctgatcacc
ggctccatcctcgccaagaaactggccgaagggcttgatgcgctggtaatggacgtaaaa
gtcggcagcggcgcgtttatgccaacctatgaactttctgaagcccttgctgaagcgatt
gtcggcgtggcaaatggcgcgggagttcgcactacggcgttgttaaccgatatgaaccag
gtgctggcttcaagcgccggtaacgcggtggaagtgcgtgaagccgtgcagttcctgacc
ggtgaataccgcaatccgcgcttgtttgacgtcactatggcgctatgcgtggagatgctg
atctccggccagctggcgaaagacgacgccgaagcgcgtgccaaactgcaggcggtgctg
gataacggtaaagcggcagaagtctttggtcgtatggtggccgcgcagaaagggccaagc
gatttcgttgagaactacgataaatacttgccgaccgccatgttgagcaaagcggtatat
gctgataccgaagggtttatcagcgcaatggatacgcgtgcgctggggatggcggtcgtc
tcgatgggcggcggccgtcgtcaggcgtctgacaccattgattacagcgttggctttacc
gacatggcccgtctgggcgacagcatcgacgggcagcgcccgctggcggtgattcatgcc
aaagacgaagccagttggcaggaagcggcgaaggccgtcaaagcggcaattatccttgac
gataaagcgccagcaagcacaccttcggtctatcgtcgaattactgaatag

DBGET integrated database retrieval system