KEGG   Staphylococcus epidermidis ATCC 12228: SE0026Help
Entry
SE0026            CDS       T00110                                 

Definition
(RefSeq) spermidine acetyltransferase
  KO
K00657  diamine N-acetyltransferase [EC:2.3.1.57]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
sep00330  Arginine and proline metabolism
sep01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SE0026
Enzymes [BR:sep01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.57  diamine N-acetyltransferase
     SE0026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_3 Acetyltransf_1 Acetyltransf_4 Acetyltransf_7 Acetyltransf_10 Acetyltransf_8 GNAT_acetyltran FR47 Acetyltransf_15 CBS
Motif
Other DBs
NCBI-GeneID: 1056857
NCBI-ProteinID: NP_763581
UniProt: A0A0H2VEE1
Position
complement(35651..36148)
Genome map
AA seq 165 aa AA seqDB search
MKLRALEYSDLLFVHELNNEYSIMSYWFEEPYESLTELQHLFDKHLLDESERRFIVEDEN
QVVGIVELVEINYIHRNCEIQIIIKPEFSGKGYAKFAFEKAIIYAFNILNMHKIYLYVDA
DNKKAIHIYESQGFKTEGLLKEQFYTKGKYKDAYFMSLLKSEYIL
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgaaactaagagcattagaatatagtgatttactttttgttcatgaattaaataatgaa
tattctattatgtcttattggtttgaagagccttatgaatccttaacggaacttcaacat
ttatttgataagcatttattagatgaatcggaaagacgttttattgttgaagatgaaaat
caagtcgtaggtattgttgaattagtagaaattaattacatccatcgtaattgtgaaata
caaataattattaaacctgagttcagtggtaaaggttatgcaaaattcgcattcgaaaaa
gcgataatttatgcattcaatattttaaatatgcacaagatctatctatatgttgatgca
gataacaaaaaagctattcatatatacgagtcacaaggatttaaaacagaaggattactc
aaagagcaattctacactaaaggtaaatataaagatgcctattttatgtcattattgaaa
tctgaatatattttgtag

DBGET integrated database retrieval system