KEGG   Staphylococcus epidermidis ATCC 12228: SE0045Help
Entry
SE0045            CDS       T00110                                 

Definition
transposase
Organism
sep  Staphylococcus epidermidis ATCC 12228
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(52968..53219)
Genome map
AA seq 83 aa AA seqDB search
MGFTRMSVRGINKAKRELGFVLIALIIRKVTAQSAKNNQKIYKKDNFYINLIEIIFFIYS
KTLCLGLAFIMLSLFNILHNRTL
NT seq 252 nt NT seq  +upstreamnt  +downstreamnt
atgggtttcactcgaatgtccgtaagaggaataaacaaagccaaaagagaactaggattt
gtgctaatagcacttattataagaaaagtaacagctcaatcagctaaaaataatcaaaaa
atttataaaaaagacaatttctatattaatttgatagaaattatcttttttatttattca
aaaactttatgtcttgggctcgctttcataatgttatctctatttaatattttacataat
agaactttataa

DBGET integrated database retrieval system