KEGG   Staphylococcus epidermidis ATCC 12228: SE0046Help
Entry
SE0046            CDS       T00110                                 

Definition
spermidine acetyltransferase
Orthology
K00657  
diamine N-acetyltransferase [EC:2.3.1.57]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sep00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(53287..53784)
Genome map
AA seq 165 aa AA seqDB search
MKLRALEYSDLLFVHELNNEYSIMSYWFEEPYESLTELQYLFDKHLLDESERRFIVEDEN
QVVGIVELVEINYIHRNCEIQIIIKPEFSGKGYAKFAFEKAINYAFDILNMHKIYLYVDT
DNKKAVHIYESQGFKTEGLLKEQFYTKGKYKDAYFMSLLKSEYIL
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgaaactaagagcattagagtatagtgatttactttttgttcatgaattaaataatgaa
tattctattatgtcttattggtttgaagaaccatatgaatccttaacggaacttcaatat
ttatttgataagcatttattagatgaatcagagagacgttttattgttgaagatgaaaat
caagtcgtaggtattgttgaattagtagaaattaattacatccatcgtaattgtgaaata
caaataattattaaacctgagttcagtggtaaaggttatgcaaaattcgcattcgaaaaa
gcgataaattatgcattcgatatattaaacatgcacaaaatttatctatatgttgataca
gataacaaaaaagctgtgcatatatacgagtcacaaggatttaaaacagaaggattactc
aaagagcaattctacactaaaggtaaatataaagatgcctattttatgtcattattgaaa
tctgaatatattttgtag

DBGET integrated database retrieval system