KEGG   Staphylococcus epidermidis ATCC 12228: SE0057Help
Entry
SE0057            CDS       T00110                                 

Definition
cassette chromosome recombinase A
Organism
sep  Staphylococcus epidermidis ATCC 12228
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(60217..61578)
Genome map
AA seq 453 aa AA seqDB search
MEEAIAYVRQSTLKQQSLATQKSLIMDTAKQYGWSNVAFYDDKKTGRHTKRSGYQKMVEI
ITSGKCKVLCCYRLNRLHRNLKNAIQFFEICKKHHITIISVNDGYFDLSKEFDCFRLNIL
MSLAEMESNNISEQTKNGIREKAKQGKLITTHAPFGYRYRKGCFVVQEEEAYTVKSVYRW
YLQGLGYKKISQHLDSNPNLIPRKPYQVRNILLNPNYCGRVINKYGTFNDIVPPIIDIDT
FEEAQERRIHKQLNRSNSRNKLKRRIKCPYCQSTLTNLTIKKENYSLRYYVCPKNMNDAY
RTCPFKSINAPELESEVLDTCKKYFEEQSFHKRLNNTILKVLKQQQMKHKETHLTQEQLI
EKLAQNRIDVKTFKRLSASCKSEENYSTYSTYQIDDKLKYVIKNKITLQDIAPFIDCIKI
TQTKQLQGIYFKNSPLNIVEQSHLITPERNEVI
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagcgattgcttatgtacgtcaaagtacactcaaacaacaaagcttagctact
caaaaatcgctcattatggataccgctaagcaatatggatggtctaatgtggcgttttat
gatgataagaaaacaggtcgacatacaaaacgttcaggttatcaaaaaatggtagaaata
attacgtctggaaaatgtaaagtattgtgttgctatcgcttgaaccgactacatcgtaat
ttgaaaaatgccatacaattctttgaaatttgtaaaaagcatcacatcacaatcatcagt
gttaacgatggatattttgatttgtctaaagagtttgattgctttcgtttgaacatactt
atgagtctagcggaaatggaatcaaacaatatcagcgaacaaacaaaaaatgggattaga
gaaaaagccaaacaaggtaagctaatcacaactcatgctccgtttggctatcgttataga
aaaggttgttttgttgtacaagaagaagaagcgtatacagttaaatcggtttatcgctgg
tacttacaaggtctaggctacaaaaagatttcccaacatttggatagtaatcctaacctt
attcctcgtaagccctatcaagttagaaatattctcttgaaccctaactattgcggtcgt
gtcatcaataaatatggcacgtttaatgatatcgttccacctattattgatattgataca
tttgaagaagcacaagagcgtcgtattcataaacaactcaatcgatccaattctagaaat
aagctaaagcgacgaatcaaatgtccttactgtcaatcaacattaacaaacttaacgata
aaaaaagagaactattctctacgttactatgtttgtcctaaaaatatgaatgacgcttat
cgtacatgcccatttaaaagtatcaatgcaccagaacttgaaagtgaagtgctcgacact
tgtaaaaagtattttgaagaacaatcgtttcataaacgattgaataacacaatactcaaa
gtcctaaaacagcaacaaatgaagcataaagaaacccatctaacacaagaacaacttatc
gaaaagctagctcaaaatcgtattgatgtaaaaacgttcaaacgtttatctgctagttgt
aaaagtgaagagaattactctacttattcaacctaccaaatcgatgacaaattaaaatat
gtcataaaaaataaaataactttacaggatatagcaccttttatcgattgcatcaaaata
actcaaactaaacaattacaaggaatctactttaaaaacagtccactcaatatcgttgaa
caatcacatttaataactcctgaaaggaatgaagtaatatga

DBGET integrated database retrieval system