KEGG   Staphylococcus epidermidis ATCC 12228: SE0062Help
Entry
SE0062            CDS       T00110                                 

Definition
copper-transporting ATPase copA
Orthology
K01534  
Cd2+/Zn2+-exporting ATPase [EC:3.6.3.3 3.6.3.5]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
64066..66000
Genome map
AA seq 644 aa AA seqDB search
MIEMKNIQEQQAHESHSHDHSHDHDHGKMPIISYFIGLVLAIIGLFLSDANLLIQNILFS
IATITAGYHVIILEGIGETVENTKLKGKFTPNSHILMGLAAIGASLIGSFWEGTLLILIF
SGAHFLEDYAEGKSKREITKLLEMNPTTAKLILPDGNTKIVDVSELKVGDQLQVLNGDQV
PIDGIILSGTTSIDESSINGESIPKEKSKGDEVFGSTINGTGTFTMEVTKENKDTVFSKI
LQLVSQNQDNQTKAASIIQKFEPKYVNIVLIAIPLVMLLAPFLFDWTWSQSVYRGLVLLV
AASPCALAAATVSVTLSTTSNLAKKGVLSKGSTYLSQLADIDAIAFDKTGTLTNGEPKVT
NYYFTHSVNEENIIDIIVALEKESNHPLANAILEKFEVKNKIDIEVTNQIGKGLTGDYNG
KNYRIGKPTSFESASEEYTQFNHDWASEGKTVVYVAENEEVIGIIALMDIPNEHAKETIN
YFKKLGIHTTLITGDSEMTGKAVGEQLGIDEVIANVMPEDKSRIIEEQKEKFGVTAMVGD
GVNDAPALVNADVGIAMGGGTDVAVEVSDLVLMQNNLSKLVQSHKISSNMGRVIRQNIIF
SMAVVAFLVVVSLLGLTDITISVIVHEGSTLVVILNGLRLLRSK
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
gtgatagaaatgaaaaatattcaagagcaacaagcacacgaaagtcatagccacgatcat
agtcatgatcatgatcacggaaaaatgccaattatttcatattttattggcttagtgttg
gctataattgggctttttttaagtgatgcaaatttattaatacaaaacatcttattttca
attgccacaatcacagccggctaccatgtaattattctcgaaggaattggagagacagtt
gaaaatactaaattaaagggaaaattcactcctaattctcatattctaatgggattagct
gcaatcggggcttctctgatagggagtttttgggaaggaacccttttgatacttattttt
tccggcgctcattttcttgaagattacgctgaaggaaaaagtaaaagagaaattactaag
ctactcgaaatgaacccaacgacagctaaattaatcttacctgatggaaacacaaaaatt
gttgatgtcagtgaattaaaagttggagatcaactccaagtgctgaacggtgatcaagtt
ccaattgatgggataattttatccggtactacctcaattgatgaatcttctattaatgga
gaaagtataccgaaagagaagtctaagggtgacgaagtttttggaagtacgattaatgga
acaggtacttttactatggaagtcactaaggaaaacaaggatactgtattctctaaaatt
ttacaattagttagtcaaaaccaagataatcaaacaaaagctgccagtatcattcaaaaa
ttcgagcctaaatatgttaatatagttttaatcgcaataccattagtaatgttacttgct
ccttttctatttgattggacatggtcgcaaagtgtttacaggggattagtgcttttagtc
gcagcttcaccgtgtgctttggcagcagctactgtatctgtaacattgtctacaacatct
aacctagctaaaaaaggcgtgctttcaaaaggaagtacttacctatcacaattagcggat
atagatgcaattgccttcgataaaacaggaacccttacgaacggagaacctaaagtaaca
aattactatttcactcattctgtgaacgaagaaaatattattgatattatagtcgccctt
gaaaaggaatccaatcacccactcgctaatgctattttagaaaaatttgaagttaaaaat
aaaatagacatcgaagttactaatcaaattggaaaaggtctgacaggagattataatgga
aaaaattatcgtattggtaagcctacttcttttgaaagtgcttctgaagagtatacccag
ttcaatcatgattgggcatcagaaggaaagacggttgtatacgtagcagaaaatgaagaa
gttattgggattatagctctaatggatattccgaatgagcatgctaaagaaacaattaat
tactttaagaaacttggtatccacacgactttaattactggtgattcggaaatgacggga
aaagctgtaggcgaacaattgggaatagacgaagttatcgctaatgtaatgcctgaagat
aaatccagaattatagaagaacaaaaagaaaaatttggagttactgccatggttggagat
ggtgtgaacgatgcaccggcccttgttaatgctgatgttggtatagctatggggggcggt
actgatgtggcagtagaagtatctgatttggttttaatgcagaacaatttatctaaatta
gtacagtctcataaaatttcctcaaatatgggtcgtgttattaggcaaaatattattttt
tcaatggcagttgttgcctttttagttgtcgttagtttgttaggattaactgatattaca
atcagtgtaattgttcatgaaggaagtactttagttgttatactaaatggacttcgatta
ttaagatctaaataa

DBGET integrated database retrieval system