KEGG   Staphylococcus epidermidis ATCC 12228: SE0075Help
Entry
SE0075            CDS       T00110                                 

Definition
cadmium resistance protein B
Orthology
K01534  
Cd2+/Zn2+-exporting ATPase [EC:3.6.3.3 3.6.3.5]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Brite
Enzymes [BR:sep01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.3  Cd2+-exporting ATPase
     SE0075
    3.6.3.5  Zn2+-exporting ATPase
     SE0075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
73390..75798
Genome map
AA seq 802 aa AA seqDB search
MSEATKPLEEKYVYRVDGFSCANCAGKFERNVKKIPGVEDAKVNFGASKISVYGEATVEE
LEKAGAFENLKVAPEKPRRQAPQEVKKDKNIYRVEGFSCANCAGKFERNVKKIPGVEDAK
VNFGASKISVYGEATIEELEKAGAFENLKVASEKPVRQATQEINQEKEDEKEEKVPFYKK
HSTLLYSTLLIVFGYLSVFVNGDENIVTTLLFVASMLIGGLSLFKVGFQNLLRFEFDMKT
LMTVAVIGGAIIGEWAEVSVVVILFAISEALERFSMDKARQSIRSLMDIAPKEALVRRKG
QEMMVHVDDIAVGDIMIVKPGQKIAMDGMVVSGYSAVNQAAITGESVPVEKAVDDEVFAG
TLNEEGLLEVEITKLVEDTTISKIIHLVEEAQGERAPSQAFVEKFAKYYTPIIMIIAALV
AVVPPLFFGASWETWVYQGLAVLVVGCPCALVISTPISIVSAIGNAAKKGVLIKGGVYLE
EMGALKAIAFDKTGTLTKGVPVVTDFNVLNKQVDENEMLSIITALEYRSQHPLASAIMKR
AEEANISYSDVVIDDFSSITGKGIKGTVDGTTYYIGSPKLFKELSNSSFDKNLEKKVATL
QNQGKTAMVVGTDKEILAIIAVADEVRESSKEVIQKLHQLGIKNTIMLTGDNKGTANAIG
SHVGVKEVQAELMPQDKLDYIKQLKSEYNNVAMIGDGVNDAPALAASTVGIAMGGAGTDT
ALETADVALMGDDLRKLPFTVKLSRKALNIIKANITFAIAIKFIALLLVIPGWLTLWIAI
LSDMGATLLVALNSLRLMRVKD
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagcaacgaagccattagaggagaaatatgtctatcgtgttgatggattttca
tgcgcaaactgtgcaggaaagtttgaaagaaatgttaaaaaaattccgggagtagaggat
gcaaaagtaaattttggagcatccaaaatttccgtttacggagaagcaacggttgaagaa
ttagaaaaagcaggtgcctttgagaaccttaaagtggctccagaaaaacctaggcggcag
gctccgcaagaggttaaaaaagacaaaaatatatatcgtgttgaagggttttcatgcgca
aactgtgcaggaaagtttgaaagaaatgttaaaaaaattccgggagtagaggatgcaaaa
gtaaattttggagcatccaaaatttccgtttacggagaagcaacgattgaagaattagaa
aaagcaggtgcttttgagaatcttaaagtggcctctgaaaaacctgtacggcaagctaca
caagagattaaccaggaaaaagaggatgaaaaagaagaaaaagtgccattctataaaaag
cacagtactttactctattcgaccttattgattgttttcggatatctttcagtctttgtt
aatggggatgagaacattgttactacattattatttgtagcatcgatgttaataggagga
ttatcgctttttaaagttggtttccaaaacttgttacgctttgaatttgacatgaaaaca
cttatgactgttgcagttataggtggtgcgattataggagaatgggcagaagtttctgtt
gttgtcatactctttgcaattagtgaagctctagaacgattttctatggataaagcgaga
caatcaattcgatcattaatggatattgcacctaaagaggcacttgttagacgaaaaggt
caagaaatgatggttcatgtagatgatattgcagttggagatattatgattgtcaaacct
ggtcaaaagattgccatggacgggatggttgtaagtgggtactctgctgttaatcaagct
gccattacaggtgagtcagtccctgttgaaaaagcggttgatgatgaagtatttgcaggt
actctaaatgaagaaggattacttgaagtagaaataactaaattagtagaagatacaacc
atttcaaaaattattcatcttgtagaggaagcacagggagaacgagcaccatctcaagcc
tttgtagaaaaatttgcgaaatattatactccgatcatcatgatcatagctgcgttagtt
gctgtagttccaccattattctttggggctagttgggaaacatgggtttatcaaggttta
gctgttttagtcgttggttgtccatgtgcgttggttatttccaccccgatttcgattgtt
tcagcaattggaaatgcagcgaaaaagggtgtcctaataaaaggtggcgtttatttagaa
gaaatgggtgccttaaaggccattgctttcgataaaacaggtactttgacaaaaggtgtc
cctgttgtaactgacttcaatgtgttgaacaaacaggtagatgaaaatgaaatgctatcc
atcattactgcattagagtatcgttctcagcaccctcttgcatcagcaatcatgaaaaga
gcagaagaggcgaatatttcttattcagatgttgtgatagatgacttctcttccattaca
ggaaaaggaattaagggtactgtagacggaacgacctattatattggaagtccaaaacta
tttaaggaactgtcaaactctagttttgataagaatttagagaaaaaagttgcaactctt
caaaatcaagggaaaactgctatggttgttggaactgacaaagaaatactagctattatt
gcagtagcagatgaagtacgtgaatcaagtaaagaagtcattcaaaaactacatcaactt
ggcatcaaaaatacaattatgcttaccggtgataataaaggtactgcgaatgccattgga
agtcatgtcggagtaaaagaagttcaggctgaattaatgcctcaggataaattggattat
attaaacaattgaaatcggaatacaacaacgtagctatgattggcgatggtgtcaatgat
gcacctgcattggcagcttccactgttggaattgcaatgggtggagctggtactgataca
gcattagaaacggcggacgttgcactaatgggagatgatttaagaaaacttccgtttacg
gtaaaactaagtcgaaaagcgctaaacataataaaagctaacattacttttgcaattgct
attaaatttattgccttattattggttattccaggttggttaacactctggattgcgatt
ctttcagatatgggtgcaactcttcttgtagcgttgaacagtttacgacttatgcgagtg
aaagattaa

DBGET integrated database retrieval system