KEGG   Staphylococcus epidermidis ATCC 12228: SE0077Help
Entry
SE0077            CDS       T00110                                 

Definition
dihydrolipoamide dehydrogenase component of pyruvate dehydrogenase E3
Orthology
K00382  
dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Glycine, serine and threonine metabolism
Valine, leucine and isoleucine degradation
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SE0077
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SE0077
   00020 Citrate cycle (TCA cycle)
    SE0077
   00620 Pyruvate metabolism
    SE0077
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SE0077
   00280 Valine, leucine and isoleucine degradation
    SE0077
Enzymes [BR:sep01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     SE0077
Exosome [BR:sep04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   SE0077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
77768..79282
Genome map
AA seq 504 aa AA seqDB search
MKIRKRLDTYYTTIFLSTNSNYSYLSKEESRMTGEVKKYVDLLVIGAGSGGYVAAIRAAQ
LGKKVVLVDKAELGGVCLNRGCIPSKALISASERVKHIKHANTMGLKVSGEVQVDMPEVV
KWKDGIVNKLTDGIRTLLKGNGVEVISGEAYLTEAHIAKIKIEDEEQIFSYKDLILAIGS
LPVELKSMPFDQKRIISSTEALQLQEVPNHLVVVGGGYIGLELGTAYAKFGAKVTILEGS
DTILSGTDPILTKTVKRHLKEIGITVITDALVQGGENTGDEVNVHVQVDGKEEIIQCDYC
LVSIGRKPNTGKIGLENIGVVLDDQGFIKINNKCQTNIEHVYAIGDCAGGDLLAHKASYE
AKIAAEVISGQNSVIDFQAMPFVIFSDPEVAYTGLTEKEAKEKGYETVSSRFPFQANARA
LSVSDADGFVQVVAEKNTKRVLGVQMVGPEVSSLIAEAVFAIEAGANAEDLSLTIHAHPT
LPEPLMEAAEGVMGHATHMLNKKQ
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaataagaaaaaggttagatacatattacacaactatattcttgagtacaaatagt
aattatagttacttatcaaaggaggaatctaggatgactggagaagtgaaaaaatatgta
gaccttttagtgataggagcagggtctggaggttatgtggcggcaatacgtgctgcccag
ttaggaaaaaaggtggtactggttgataaggcggagttaggaggagtttgccttaatcga
gggtgtatcccttcaaaagctcttattagtgcatctgaacgagtcaaacacattaaacat
gccaatacaatggggcttaaggtttcgggtgaggttcaagttgatatgccagaagtagta
aagtggaaggacggaatcgtgaacaagctaacagatgggattcgcaccttgttaaaagga
aatggtgtagaggtcatcagtggggaagcctatctcactgaagcacatattgcaaaaata
aaaatagaggacgaggaacagattttttcctacaaagatttaattcttgcaataggttct
ttgccagtcgagttaaaaagtatgccatttgatcaaaaaagaatcatttcttcaacggag
gcattgcaactacaggaagtacccaatcatttagttgtggtaggtggtggttatatcggt
ttagagttaggtactgcttatgcaaagtttggggcaaaagtgaccatccttgagggatcg
gatacaattttgtccgggacagatcctatcctaacaaaaacagtaaaacgtcatttaaag
gaaattggaatcactgttataacggatgcccttgttcaaggtggagaaaatacaggcgat
gaagttaacgtccatgttcaagttgatggaaaggaagaaattattcaatgtgattattgc
ttagtttctattgggagaaaaccaaacacaggtaaaattggtctggaaaatatcggagta
gtattagacgaccaaggatttattaagataaataacaaatgtcaaacaaacattgaacat
gtttatgcaataggggattgtgctggtggtgacctccttgctcataaagctagttatgaa
gcaaagatagcagccgaagtgatcagtggtcaaaatagtgtgattgattttcaagcgatg
ccttttgttatcttcagcgatcctgaagtagcctatacaggtttaacagagaaggaagca
aaggaaaaaggatacgaaacagtatccagtcgttttccattccaagcaaatgctagggcg
ttatctgtctcggatgcagatggctttgtacaagttgtagccgaaaagaatacgaaaaga
gtgttaggagtacagatggttggaccagaggtatcctctctgattgcagaggctgttttt
gcgattgaggctggggcaaatgcggaagatcttagccttacgattcatgctcatcctacc
ttaccagagccacttatggaagcagcagaaggtgtgatgggacatgctacacatatgttg
aataaaaagcaataa

DBGET integrated database retrieval system