KEGG   Staphylococcus epidermidis ATCC 12228: SE0080Help
Entry
SE0080            CDS       T00110                                 

Definition
regulatory protein
Orthology
K00383  
glutathione reductase (NADPH) [EC:1.8.1.7]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SE0080
Enzymes [BR:sep01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.7  glutathione-disulfide reductase
     SE0080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
81622..82983
Genome map
AA seq 453 aa AA seqDB search
MRRIMMTKKYDLIVIGTGSAGSITAAKCNKAGWNVAMVDDRPFGGTCALRGCDPKKVLHG
AAELIDWNKRMVKNGVPSEVSINWKDLMNFKRTFTDDVPEKKEEALNKQGIDTYHGNASF
VSEDKLEVNKEVLEGSHFLIASGAKPTPLPIKGEEHLTYSDEFLELDELPQRIVFVGGGY
ISFEFAHIAARAGSEVHIIHRGQRPLENFDIDLVDILLEKSKEIGIQVHLQHSVESIEKE
QGKFHVYARKKEDITRFEADIVIHGAGRVPALDMNLEKGNIERKKHGVHVNEYLQSVSNP
NVYAAGDAAATDGLPLTPVASADSHVVASNLLKGNSKKIEYPVIPSAVFTVPKMASVGMS
EEEAKNSGRNIKVKQKNISDWFTYKRTNEDFAAFKVLIDEDSDQVVGAHLISNEADELIN
HFATAIRFGISTKELKQMIFAYPTAASDIAHML
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
gtgaggaggataatgatgacaaagaaatacgatcttattgtgattggtacaggttctgcg
gggtcaatcacagcagcaaaatgtaataaagccggctggaatgtagctatggtagatgac
aggccgtttggaggcacgtgtgcactacgtggatgtgacccaaaaaaggttctacatggt
gctgccgagcttattgattggaacaaacggatggttaagaatggagtaccgtctgaagtc
tccatcaactggaaagatcttatgaattttaaaagaacctttacagatgatgtcccggaa
aaaaaagaggaagcattgaataaacagggaatcgatacgtatcatggcaatgcatctttc
gtgagtgaggacaaacttgaagtgaataaagaagtgctcgaggggagtcatttcttgatc
gctagtggtgcgaaacctacccctttacccataaaaggagaagaacatcttacttatagt
gatgagtttttggagttggatgaattaccacaaagaatcgtctttgttggtggtgggtat
atttcgtttgaatttgctcatatcgcggcacgtgctggatcagaagttcatattatccat
cgaggtcaaagacctttggagaattttgatatagatcttgtagatatccttttagaaaag
tcgaaagagattggcatacaggtacatcttcaacattccgttgaatccattgaaaaagaa
caaggaaagtttcatgtgtacgctcgaaaaaaagaggatataacgcggtttgaagcagac
attgttattcatggtgctggacgggtccctgccttagatatgaatcttgaaaaagggaat
atagaaaggaaaaaacatggtgtccatgttaatgagtatttgcaaagtgtaagtaacccg
aatgtctatgcagctggagatgctgcagcaacggatggcttgcccctcacacctgtagcc
agtgcagattctcatgtcgtagcatctaatttattgaaagggaacagcaaaaaaattgaa
tatcccgtgattccatctgctgtatttaccgtacctaaaatggcatcggtaggtatgagc
gaggaggaagccaaaaactctggccggaatattaaagtaaagcagaaaaacatctccgac
tggtttacgtataaacggacaaatgaggactttgctgcgtttaaagtgctaattgacgag
gatagtgatcaagttgtcggtgctcatttgattagtaatgaagccgatgaactaattaac
cactttgcaacagccattcgctttggaatttcaaccaaagaattgaaacaaatgatattt
gcctatccaacggcagcttcggacattgcacacatgttgtaa

DBGET integrated database retrieval system