KEGG   Staphylococcus epidermidis ATCC 12228: SE0080Help
Entry
SE0080            CDS       T00110                                 

Definition
regulatory protein
Orthology
K00383  
glutathione reductase (NADPH) [EC:1.8.1.7]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:sep00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
81622..82983
Genome map
AA seq 453 aa AA seqDB search
MRRIMMTKKYDLIVIGTGSAGSITAAKCNKAGWNVAMVDDRPFGGTCALRGCDPKKVLHG
AAELIDWNKRMVKNGVPSEVSINWKDLMNFKRTFTDDVPEKKEEALNKQGIDTYHGNASF
VSEDKLEVNKEVLEGSHFLIASGAKPTPLPIKGEEHLTYSDEFLELDELPQRIVFVGGGY
ISFEFAHIAARAGSEVHIIHRGQRPLENFDIDLVDILLEKSKEIGIQVHLQHSVESIEKE
QGKFHVYARKKEDITRFEADIVIHGAGRVPALDMNLEKGNIERKKHGVHVNEYLQSVSNP
NVYAAGDAAATDGLPLTPVASADSHVVASNLLKGNSKKIEYPVIPSAVFTVPKMASVGMS
EEEAKNSGRNIKVKQKNISDWFTYKRTNEDFAAFKVLIDEDSDQVVGAHLISNEADELIN
HFATAIRFGISTKELKQMIFAYPTAASDIAHML
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
gtgaggaggataatgatgacaaagaaatacgatcttattgtgattggtacaggttctgcg
gggtcaatcacagcagcaaaatgtaataaagccggctggaatgtagctatggtagatgac
aggccgtttggaggcacgtgtgcactacgtggatgtgacccaaaaaaggttctacatggt
gctgccgagcttattgattggaacaaacggatggttaagaatggagtaccgtctgaagtc
tccatcaactggaaagatcttatgaattttaaaagaacctttacagatgatgtcccggaa
aaaaaagaggaagcattgaataaacagggaatcgatacgtatcatggcaatgcatctttc
gtgagtgaggacaaacttgaagtgaataaagaagtgctcgaggggagtcatttcttgatc
gctagtggtgcgaaacctacccctttacccataaaaggagaagaacatcttacttatagt
gatgagtttttggagttggatgaattaccacaaagaatcgtctttgttggtggtgggtat
atttcgtttgaatttgctcatatcgcggcacgtgctggatcagaagttcatattatccat
cgaggtcaaagacctttggagaattttgatatagatcttgtagatatccttttagaaaag
tcgaaagagattggcatacaggtacatcttcaacattccgttgaatccattgaaaaagaa
caaggaaagtttcatgtgtacgctcgaaaaaaagaggatataacgcggtttgaagcagac
attgttattcatggtgctggacgggtccctgccttagatatgaatcttgaaaaagggaat
atagaaaggaaaaaacatggtgtccatgttaatgagtatttgcaaagtgtaagtaacccg
aatgtctatgcagctggagatgctgcagcaacggatggcttgcccctcacacctgtagcc
agtgcagattctcatgtcgtagcatctaatttattgaaagggaacagcaaaaaaattgaa
tatcccgtgattccatctgctgtatttaccgtacctaaaatggcatcggtaggtatgagc
gaggaggaagccaaaaactctggccggaatattaaagtaaagcagaaaaacatctccgac
tggtttacgtataaacggacaaatgaggactttgctgcgtttaaagtgctaattgacgag
gatagtgatcaagttgtcggtgctcatttgattagtaatgaagccgatgaactaattaac
cactttgcaacagccattcgctttggaatttcaaccaaagaattgaaacaaatgatattt
gcctatccaacggcagcttcggacattgcacacatgttgtaa

DBGET integrated database retrieval system