KEGG   Staphylococcus epidermidis ATCC 12228: SE0085Help
Entry
SE0085            CDS       T00110                                 

Definition
dihydrolipoamide dehydrogenase
Orthology
K00520  
mercuric reductase [EC:1.16.1.1]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Brite
Enzymes [BR:sep01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.1  With NAD+ or NADP+ as acceptor
    1.16.1.1  mercury(II) reductase
     SE0085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
85268..86911
Genome map
AA seq 547 aa AA seqDB search
MTQNSYKIPIQGMTCTGCEEHVTEALEQAGAKDVSADFRRGEAIFELSDDQIEKAKQNIS
AAGYQPGEEESQPSENSVDFNRDGDYDLLIIGSGGAAFSAAIKANENGAKVAMVERGTVG
GTCVNIGCVPSKTMLRAGEINGLAQNNPFTGLQTSTGAADLAQLTEQKDGLVSQMRQEKY
IDLIEEYGFDLIRGEASFIDDKTIQVNGQNITSKSFLIATGASPAVPEIPGMNEVDYLTS
TSALELKEVPQRLAVIGSGYIAAELGQMFHNLGTEVTLMQRSERLFKTYDPEISEAIDES
LTEQGLNLITGVTYQKVEQNGKSTSIYIEVNGQEQVIEADQVLVATGRKPNTETLNLESA
GVKTGKKGEVLTNEYLQTSNNRIYAAGDVTLGPQFVYVAAYEGGIVANNALGLAKRKIDL
RFVPGVTFTNPSIATVGLTEQQAKEKGYDVKTSVLPLDAVPRALVNHETTGVYKLVVNAQ
TQKLIGAHIVSENAGDVIYAATLAVQFGLTIEDLTDSFAPYLTMAEGLKLAALTFDKDVS
KLSCCAG
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgactcaaaattcatataaaatacccattcaaggcatgacatgcacaggctgtgaagaa
catgtaaccgaagcattggaacaagccggagctaaagatgtttcggccgatttccgacgc
ggtgaggccatttttgaactcagcgatgatcagatcgaaaaggctaagcaaaatatttcg
gcagccggctatcaacccggagaggaagaaagccagccctctgaaaacagtgtagatttc
aatcgggatggcgattacgatcttctgattattggttccggcggtgcggcgttttctgca
gctatcaaggccaatgaaaacggggcgaaagtggccatggtagaacggggaaccgtcggg
gggacctgcgttaacatcggttgtgtaccgtcaaaaaccatgcttcgtgccggtgaaata
aacggtctcgcccaaaacaatccgtttaccggacttcaaacgagtaccggtgctgcggac
cttgcccaattgaccgaacaaaaagatggattagtcagtcaaatgcgtcaagaaaaatat
atagacttgatcgaagaatatggatttgatctcattcgtggcgaggcctcgtttatcgac
gataagacgatacaagtgaatggacaaaacatcacgtctaaaagctttttaatcgcaacg
ggggcttctccggctgttccggaaatcccgggaatgaatgaggttgattatttaacaagt
acatccgcactcgaattaaaagaggttccacaacgattggcagtgatcggttctggctat
atcgcagcggaattaggtcaaatgtttcacaacctcggaacagaagtgactctcatgcaa
agaagcgagcgtctgtttaaaacctacgatcctgaaatttccgaagccatcgatgaatcc
ttaactgagcaaggacttaacctgatcactggggtcacttatcaaaaggttgagcaaaac
ggtaagtcgacaagcatttatattgaagtgaacggtcaagaacaagtcatcgaagccgat
caagtcctcgtggcaacaggaagaaagccgaacacagagactttaaaccttgaatcagca
ggtgtgaaaacagggaaaaaaggcgaagtgctgaccaatgaatatttgcaaacgtcgaat
aaccgaatatatgccgcgggcgatgtgaccctcggtccgcaattcgtttatgttgcagct
tatgaaggcgggattgtggcaaataatgcgttgggtctagcgaaacgcaaaatcgatctt
cgctttgttcccggcgtaaccttcaccaatccatcgatcgccacagtcggcttgactgaa
caacaggcaaaagaaaaaggttacgatgtcaaaacatcggtccttccgttggacgctgta
ccgcgggccttagtcaatcacgaaacaacaggggtctataaacttgtagtcaacgcccaa
acccagaaattgatcggggcgcacattgtgagtgaaaatgctggagatgtgatttatgcg
gcaacgttagcggttcaatttggattgaccattgaagaccttacggatagctttgcgcct
tatttaacgatggctgaaggattaaagcttgcagccttgacgtttgataaagacgtatcg
aaattatcttgttgtgcaggctaa

DBGET integrated database retrieval system