KEGG   Staphylococcus epidermidis ATCC 12228: SE0112Help
Entry
SE0112            CDS       T00110                                 

Definition
pyridoxal-deC
Organism
sep  Staphylococcus epidermidis ATCC 12228
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(107415..108839)
Genome map
AA seq 474 aa AA seqDB search
MEMEFNENNIDLETIIRDEVNKYLSRDIGDLPATQQAPLELREKYEKMEVPNKGRDIYEV
LKDLNNEVLNYLYRPNHPRSFSFIPGPASRLSWLGDILTTANNIHASNFANATLPINIER
NLINYLVGKIGYEIKPAGGVFVSGGSMANLTAIVAARDAQVEMEDIKKATVYLTSQTHHS
VGKALHVAGFLKNNIRRIEYNDDFTMNTDSLKAAIDKDIEEGYKPAMVIATAGTTNTGSV
DDFTTLGDICDHYNLWLHVDGAYGLSHILSDKAQHLFKGIERSDSASWDAHKLLFQTYSC
AMVIVKEKNHLLQSFGEDAEYLDDIASDDDVIDPEMLGIELTRPARALKLWITLQVIGED
EIIERIKYGEGLAEYAEEYVSSLDNWRIISHANLSIVNFRYENSDLTEAQNNQLNSMAAQ
KIADSGYAIAYTTVLNNQRVIRLCTTNPLTTHDDIRETINRLDQYIGDYDMKDA
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggaaatggaattcaatgagaacaatatcgacttagagacgattatcagagatgaagtt
aataaatatttatctagagatattggagacttacctgcgacacaacaggcaccgctcgag
ttgagagagaaatatgaaaagatggaagtgccgaataaagggcgagatatctatgaagta
ctcaaagatttaaataatgaagtgctgaattatttatatcgtccgaaccatccacgttca
ttctcatttataccaggtccagcatcacgtctatcatggcttggagacattttaacaaca
gcaaataatatccatgcctctaattttgccaatgcgacgctgccaattaatattgagcgt
aatttaattaactacttggtaggaaaaatcggttatgagatcaaaccggccggtggtgtc
tttgtatctggcggttcaatggccaatttaacagctatcgttgcggctagagatgcacag
gtagaaatggaagatattaaaaaagcaaccgtttatcttacatctcaaacgcatcattct
gtaggcaaagccttgcatgttgcaggcttccttaaaaataatatccgcagaattgagtac
aacgatgactttacaatgaatacagatagcttaaaagccgcaattgataaagatattgaa
gaaggttacaaacctgctatggtgattgcgactgcaggcacgactaatacaggttctgtc
gatgatttcaccacacttggagatatttgtgatcactacaatctatggctccatgtagac
ggtgcttatggactatcacatatcttatccgataaagcacaacacttatttaaaggcatt
gaacgttcagatagtgccagttgggatgctcacaaattactgttccaaacatatagttgc
gctatggtaatcgtgaaagaaaagaatcatctgctgcaaagctttggcgaagatgctgag
tacttggatgatattgcttcagatgatgatgtgattgatccagaaatgttaggcattgaa
cttacacgccctgcacgtgctttaaaattatggattactctgcaagtcattggtgaagat
gaaattatcgagcgcattaaatacggcgaaggtttagcagaatatgcagaagaatacgtg
tcaagtctcgataactggcgtattatctcacacgctaatctttccattgtgaacttcaga
tatgaaaacagtgatttaactgaagcacaaaataatcaactcaatagcatggctgcgcaa
aaaattgcagattctggttatgccattgcttataccacagtattgaataaccaacgtgtc
attcgtttatgtacaacgaacccattaacgacacatgatgatatcagagaaacaataaat
cgccttgatcagtatattggtgattacgatatgaaagatgcttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system