KEGG   Staphylococcus epidermidis ATCC 12228: SE0114Help
Entry
SE0114            CDS       T00110                                 

Definition
hypothetical protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
110268..111083
Genome map
AA seq 271 aa AA seqDB search
MTLKKNSKTERCENVKHSKKLFLCVSFLLITIFIGGGGFMNKDESKETEIKKSFNKTLSM
YPIKNLEDLYDKEGYRDEEFNKGDKGMWIVHSEMNIQKKGKALESRGMVLYMDRNTRTTH
GYFILTKIKDTGKVKTDDSEKKYPVKLENNKIIPTKQIKDEKLKKEIENFKFFSQYGNFK
DLKDYKDGEVSYNPNAPNYSAKYQLSNNDYNVKQIRKRYDIPTEQAPKLLLKGTGDLKGS
STGSKNIEFTFVEKKGENIYFTDSVEYTPSG
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgactttaaaaaagaattcaaaaacagagagatgtgaaaatgtgaaacattcgaaaaag
ttatttttatgcgtcagttttttattaataacgatttttattggtggaggtggatttatg
aataaagacgagagtaaagaaacggaaatcaaaaaaagttttaataaaacgttaagtatg
tatcctattaaaaacttagaagatctatacgataaagaaggatatcgagacgaagaattt
aataaaggcgataaaggaatgtggatagttcactctgaaatgaatatacaaaaaaagggg
aaagcattggaatcaagagggatggttttatatatggatagaaatacaagaaccactcac
ggctattttattcttaccaaaataaaagatacaggtaaagtcaaaacagatgacagtgaa
aagaaatatccagtaaagctagaaaataataaaataattccaacaaaacaaattaaagat
gaaaagttaaaaaaagaaatagaaaactttaagtttttctcacaatatggcaattttaaa
gatttaaaagattataaagacggtgaggtatcttataatcctaatgcgcctaattattca
gctaaatatcaactcagtaataatgattataatgtaaaacaaataagaaaaagatatgat
attccaaccgaacaagcccctaagttgttattaaaaggtacaggtgatttaaaaggttca
tccacaggttctaaaaatattgaatttacttttgtagagaaaaaaggagaaaatatttat
tttactgacagcgttgaatacacgccaagtgggtaa

DBGET integrated database retrieval system