KEGG   Staphylococcus epidermidis ATCC 12228: SE0117Help
Entry
SE0117            CDS       T00110                                 

Definition
ABC transporter ATP-binding protein
Orthology
K01990  
ABC-2 type transport system ATP-binding protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
Module
ABC-2 type transport system
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
112049..112954
Genome map
AA seq 301 aa AA seqDB search
MNEIVIKGLSKSYDGKKDALNSLDLVIPNGMFGILGRNGSGKSTLMNIIATILQPSKGTV
TINGIEIKNSQKIRQMIGYLPQDFDFYPNMKVSEVLYYLGFLSKINQKDFDKYVDLILRK
VNLIDYKNKKVKSLSGGMKKRLGIAQAILHDPKVIIVDEPTAGLDPEERVRLRNLLSDLA
ENKIVIISTHIVSDIESTCNKIAILDKGSLVYKGDIPSLIQQSDDHIYEINLSPSELESF
RENDLFITKTQEIDNKLKVRFISETKVANAKKVKADFEDAYMYFLKKQQGGLNHASIYNG
I
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaatagttatcaaaggtttgagtaaatcatatgatggaaagaaagatgcgctt
aattcattggatttagtaattcccaatggtatgtttggtattttaggaagaaacggatct
ggtaaatctacattaatgaatatcattgcaacaattcttcaaccaagtaagggaacagta
acaattaatggtattgaaattaaaaattcacaaaagattagacaaatgattggttactta
cctcaagattttgatttttatcctaatatgaaagtctcggaagttttatactatttaggt
tttttatctaaaataaatcaaaaggatttcgataaatatgtagatttaattcttcgtaag
gttaatctaattgattataaaaataaaaaggttaaaagtttatctggtggaatgaaaaaa
agattaggtatagcgcaagccattttacatgaccccaaagtaattattgtcgatgaacca
acggcgggattagatccagaagaaagagtaaggctacgcaatttactatctgatttagct
gaaaacaaaattgtgattatatcaacgcacattgtgagcgacattgaatcaacttgtaat
aagattgctattttagataaagggagtcttgtatataaaggtgacataccgtcgttgata
caacaaagtgatgatcatatttatgaaatcaatctatctccttcggaattagaatcattt
agagaaaacgacttatttattactaaaactcaagaaattgataataaattaaaagttagg
tttatttctgaaacaaaagttgcaaacgctaaaaaagttaaagctgattttgaagatgct
tatatgtattttttaaaaaaacaacaaggaggtttgaatcatgcgtctatttataatgga
atttaa

DBGET integrated database retrieval system