KEGG   Staphylococcus epidermidis ATCC 12228: SE0120Help
Entry
SE0120            CDS       T00110                                 

Definition
(RefSeq) response regulator
Organism
sep  Staphylococcus epidermidis ATCC 12228
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-GeneID: 1056591
NCBI-ProteinID: NP_763675
UniProt: A0A0H2VFU7
Position
114705..115373
Genome map
AA seq 222 aa AA seqDB search
MMYNIMIVDDEEKIVSFIEESLYLEGFNTIVAYNGRDVLKQIDDKIDLIILDIKMPYIDG
FEVAQSLKESNIPIIFLTAKDNLDTRLKCFSLGAKDYLPKPFYMEELIIRIKNVLNQSHS
QSLTPNIKKTKELIIYYDTYRIDVNNMTIDITKKEFEIIKLLSLNPQYYFSKEQIYDSIN
LNKTGNTQVVAEHIRKIRKKLSCYSRFEYIDTKWGVGYKWLE
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
gtgatgtataacataatgattgtcgacgatgaagaaaaaattgtgtcatttatagaagaa
agtttatacttagaaggttttaacactattgtcgcttataatggacgtgacgttttaaaa
caaatcgatgacaaaattgatttaatcattttagatattaaaatgccgtatatagatggg
tttgaagttgctcaatcacttaaagagagtaatatacctattatttttcttactgctaaa
gataatcttgatactagactgaaatgtttctcgcttggtgcaaaggattacttacctaag
cctttctatatggaagaacttataattcgaattaaaaatgtacttaatcaaagtcattct
caaagtttgactcccaacataaaaaaaactaaagaattaatcatttattacgatacatat
agaattgacgtaaataacatgacgatagatattacaaaaaaagaatttgaaattataaaa
ttactatctttaaatcctcaatattattttagtaaagaacagatatatgattcgattaat
ttaaataagacaggcaatactcaagttgttgctgaacatatacgtaaaataagaaaaaag
ttaagttgttatagtcgttttgaatacatcgatacaaagtggggagttggatataaatgg
ctagagtag

DBGET integrated database retrieval system