KEGG   Staphylococcus epidermidis ATCC 12228: SE0120Help
Entry
SE0120            CDS       T00110                                 

Definition
response regulator
Organism
sep  Staphylococcus epidermidis ATCC 12228
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
114705..115373
Genome map
AA seq 222 aa AA seqDB search
MMYNIMIVDDEEKIVSFIEESLYLEGFNTIVAYNGRDVLKQIDDKIDLIILDIKMPYIDG
FEVAQSLKESNIPIIFLTAKDNLDTRLKCFSLGAKDYLPKPFYMEELIIRIKNVLNQSHS
QSLTPNIKKTKELIIYYDTYRIDVNNMTIDITKKEFEIIKLLSLNPQYYFSKEQIYDSIN
LNKTGNTQVVAEHIRKIRKKLSCYSRFEYIDTKWGVGYKWLE
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
gtgatgtataacataatgattgtcgacgatgaagaaaaaattgtgtcatttatagaagaa
agtttatacttagaaggttttaacactattgtcgcttataatggacgtgacgttttaaaa
caaatcgatgacaaaattgatttaatcattttagatattaaaatgccgtatatagatggg
tttgaagttgctcaatcacttaaagagagtaatatacctattatttttcttactgctaaa
gataatcttgatactagactgaaatgtttctcgcttggtgcaaaggattacttacctaag
cctttctatatggaagaacttataattcgaattaaaaatgtacttaatcaaagtcattct
caaagtttgactcccaacataaaaaaaactaaagaattaatcatttattacgatacatat
agaattgacgtaaataacatgacgatagatattacaaaaaaagaatttgaaattataaaa
ttactatctttaaatcctcaatattattttagtaaagaacagatatatgattcgattaat
ttaaataagacaggcaatactcaagttgttgctgaacatatacgtaaaataagaaaaaag
ttaagttgttatagtcgttttgaatacatcgatacaaagtggggagttggatataaatgg
ctagagtag

DBGET integrated database retrieval system