KEGG   Staphylococcus epidermidis ATCC 12228: SE0142Help
Entry
SE0142            CDS       T00110                                 

Definition
(RefSeq) hypothetical protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF576
Motif
Other DBs
NCBI-GeneID: 1056521
NCBI-ProteinID: NP_763697
UniProt: Q8CU21
Position
134847..135632
Genome map
AA seq 261 aa AA seqDB search
MKHSSKIIVFVSFLILTIFIGGCGFINKEDSKETEIKQNFNKMLNVYPTKNLEDFYDKEG
YRDEEFDKDDKGTWIIRSEMTKQPKGKIMISRGMVLYINRNTRTTKGYFLISEITEDKNG
FAHNKDKKYPVVMKHNKIIPTKPIPDDKLKKEIENFKFFVQYGNFKNLKDYKDGEISYNP
NVPSYSAKYQLSNNDYNVKQLRKRYDIPTKKAPKLLLKGDGDLKGASVGRKDLEFTFVEN
KEENIFFTDSINFKPTERDES
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaaacattcaagcaaaataatagtatttgtaagtttcttaattttaacgatttttatt
ggaggatgtggttttataaataaagaagatagtaaagaaacggaaatcaaacaaaacttt
aataaaatgttaaacgtgtatccaactaaaaatctagaggatttttacgataaagagggc
tatcgtgatgaagagtttgataaagatgacaaaggaacttggattattagatctgaaatg
acaaaacagccaaaaggtaaaattatgatctcaagaggtatggttctctatatcaatcgc
aatactagaacaacaaaaggatactttttaattagtgagataacagaggacaaaaatggc
tttgcgcataataaagataaaaaatatcctgtcgtaatgaaacataataaaattattcca
acgaagcctataccagacgataagttaaaaaaagaaattgagaactttaaattttttgtg
caatatggcaattttaaaaacttaaaagattataaagacggagagatatcttacaatcct
aatgttcctagttattctgcgaaatatcaattgagtaataatgactataacgtgaaacaa
ttaagaaaaagatatgacatcccaactaaaaaagcacctaaattattgttaaaaggggat
ggcgacttaaaaggggcatctgtaggtcgtaaagacctagaattcacctttgtagagaat
aaggaagaaaacatcttttttacagatagtattaatttcaaaccgactgagcgtgatgaa
tcatga

DBGET integrated database retrieval system