KEGG   Staphylococcus epidermidis ATCC 12228: SE0144Help
Entry
SE0144            CDS       T00110                                 

Definition
hypothetical protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
135950..136705
Genome map
AA seq 251 aa AA seqDB search
MRYLKRITIYISLLILVSGCGNNKEAEIKQNFNKTLSMYPIKNLENFYDKEGFRDEEFDK
DDKGTWIINSKMIVEPKGKDMEARGMVLHINRNTRTTKGDFIIKRITEDNKGIPDVKDKK
YPVKMENNKIIPTKQIKDKKLKKEIENFKFFVQYGNFKNLKHYKDGEISYNPNVPSYSAK
YQLSNNGYNVKQLRKRYDIPTNQAPKLLLKGTGDLKGSSVGYNHLEFTFVENKKENIYFT
DSINFNPSRGD
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgttatctaaagagaataactatatacataagtttattaattttggtaagtggttgt
ggaaacaataaagaagctgaaatcaaacaaaactttaataaaacgttaagtatgtatcca
attaaaaatctagaaaacttttatgataaagaaggttttcgagatgaagagtttgataaa
gatgacaaaggaacttggattattaattctaaaatgattgttgaaccgaaagggaaagat
atggaagcaagagggatggttttacatataaatagaaatacgagaacaactaaaggtgac
tttattataaaacgaataacagaagataataaaggaatacctgatgttaaagataaaaag
tatccagtaaaaatggaaaacaacaaaattatcccaacaaagcaaattaaagataaaaaa
ttaaaaaaagaaattgagaactttaaattttttgtgcaatatggcaattttaaaaactta
aagcattataaagacggagagatatcttacaatcctaatgtacctagttattctgcgaaa
tatcaattgagtaataatggttataacgtgaaacaattaagaaaaagatatgatattcca
acgaatcaagctcctaaattattattgaaagggacaggagatttaaaaggatcctctgta
ggttataaccatcttgaatttacttttgtagaaaataaaaaagaaaatatttattttact
gacagtataaactttaacccaagtaggggggattaa

DBGET integrated database retrieval system