KEGG   Staphylococcus epidermidis ATCC 12228: SE0165Help
Entry
SE0165            CDS       T00110                                 

Definition
two-component response regulator
Orthology
K07720  
two-component system, response regulator YesN
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Two-component system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:sep02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(153010..153765)
Genome map
AA seq 251 aa AA seqDB search
MFKVVICDDERIIRQGLKQMIPWKEYHFTTIYTATDGVEALSLIRQHQPELVITDIRMPR
KNGVDLLDDIKDLDCQVIILSSYDDFEYMKAGIQHHVLDYLLKPVDHTQLEHILDILVQR
LLERPHSTNDDAAYYTAFQPLLKIDYDDYYVNQILSQIKQHYHKKVTVLDLINPIVVSES
YAMRTFKEHVGITIVDYLNRYRILKSLHLLDQHYKHYEIAEKVGFSEYKMFCYHFKKYLH
MSPSDYNKLSK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaagtagttatttgtgatgatgaacggattatacgacaaggtttaaaacaaatg
attccatggaaggaatatcattttacaactatttacactgccacagacggcgtagaagca
ttgtctttaattcgccaacatcaacctgaactcgtcattactgatatacgaatgcctcga
aaaaatggtgttgacctactagatgacatcaaagaccttgattgccaagttatcatttta
tctagttatgacgacttcgaatatatgaaagccggcattcaacaccatgttcttgattat
ttactaaagccagtagaccacactcaattagagcatattctagacatattagttcaaagg
ttattagaacgtccacattctaccaatgatgacgcggcatattatactgcctttcaacca
ttattaaaaattgattacgatgactattatgtcaatcaaattttgtctcaaatcaagcaa
cattatcacaagaaagtgactgttcttgacttaattaatcctattgttgtaagtgagtca
tacgccatgaggacgtttaaagaacatgtaggcattacgatagttgattatttaaatcgt
tatcgtattttaaaatcattacatcttttagaccagcactacaagcattatgaaattgct
gaaaaagtaggtttttctgagtataagatgttttgctatcattttaaaaaatatttacat
atgtcaccaagtgattataataagctatcaaaatag

DBGET integrated database retrieval system