KEGG   Staphylococcus epidermidis ATCC 12228: SE0165Help
Entry
SE0165            CDS       T00110                                 

Definition
(RefSeq) two-component response regulator
  KO
K07720  two-component system, response regulator YesN
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
sep02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sep00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SE0165
Two-component system [BR:sep02022]
 Other families
  YesM-YesN [MD:M00519]
   SE0165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg HTH_18 HTH_AraC
Motif
Other DBs
NCBI-GeneID: 1056427
NCBI-ProteinID: NP_763720
UniProt: Q8CQE3
Position
complement(153010..153765)
Genome map
AA seq 251 aa AA seqDB search
MFKVVICDDERIIRQGLKQMIPWKEYHFTTIYTATDGVEALSLIRQHQPELVITDIRMPR
KNGVDLLDDIKDLDCQVIILSSYDDFEYMKAGIQHHVLDYLLKPVDHTQLEHILDILVQR
LLERPHSTNDDAAYYTAFQPLLKIDYDDYYVNQILSQIKQHYHKKVTVLDLINPIVVSES
YAMRTFKEHVGITIVDYLNRYRILKSLHLLDQHYKHYEIAEKVGFSEYKMFCYHFKKYLH
MSPSDYNKLSK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaagtagttatttgtgatgatgaacggattatacgacaaggtttaaaacaaatg
attccatggaaggaatatcattttacaactatttacactgccacagacggcgtagaagca
ttgtctttaattcgccaacatcaacctgaactcgtcattactgatatacgaatgcctcga
aaaaatggtgttgacctactagatgacatcaaagaccttgattgccaagttatcatttta
tctagttatgacgacttcgaatatatgaaagccggcattcaacaccatgttcttgattat
ttactaaagccagtagaccacactcaattagagcatattctagacatattagttcaaagg
ttattagaacgtccacattctaccaatgatgacgcggcatattatactgcctttcaacca
ttattaaaaattgattacgatgactattatgtcaatcaaattttgtctcaaatcaagcaa
cattatcacaagaaagtgactgttcttgacttaattaatcctattgttgtaagtgagtca
tacgccatgaggacgtttaaagaacatgtaggcattacgatagttgattatttaaatcgt
tatcgtattttaaaatcattacatcttttagaccagcactacaagcattatgaaattgct
gaaaaagtaggtttttctgagtataagatgttttgctatcattttaaaaaatatttacat
atgtcaccaagtgattataataagctatcaaaatag

DBGET integrated database retrieval system