KEGG   Staphylococcus epidermidis ATCC 12228: SE0187Help
Entry
SE0187            CDS       T00110                                 

Definition
hypothetical protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
177776..178036
Genome map
AA seq 86 aa AA seqDB search
MSYNPNVPSYSAEYQLSNEDDNVKQLRKKYDIPTKKAPKLILKGDGDLKGSSIGHKHVEL
SFVRNKEESIYFSDSVEFNPSEVNNE
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
gtgtcttataacccaaacgtaccaagttattcggcagagtaccaattaagtaatgaagat
gacaatgtgaaacagttaagaaagaaatatgatatccctacaaaaaaggcaccaaaatta
atattaaaaggtgatggagatcttaaaggttcatctataggacataaacatgttgagtta
tcttttgtcagaaacaaagaagaaagcatctacttttcagatagtgtggaatttaatcca
agtgaggtaaataatgagtag

DBGET integrated database retrieval system