KEGG   Staphylococcus epidermidis ATCC 12228: SE0197Help
Entry
SE0197            CDS       T00110                                 

Definition
acetoin(diacetyl)reductase
Orthology
K03366  
meso-butanediol dehydrogenase / (S,S)-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.- 1.1.1.76 1.1.1.304]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Butanoate metabolism
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:sep00650]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
188759..189532
Genome map
AA seq 257 aa AA seqDB search
MSKTAIITGAAGGLGKGIAERLANDGFNIVLQDINEALLLETEKEFKEKGYQAVAYKSDV
SKKKEQEELVQFAVTEFGQLDVMVNNAGVDAVTPILEIGEEELSKLFNINVFGTLFGIQA
AANQFIKQKSKGKIINACSIAGHESYEVLGTYSATKHSVRSFTQTAAKELADKGITVNAY
CPGVAKTEMWDRIDEEMVKLDDSLEIGDAFEAFSSEIKLGRYQEPSDVANLVSFLASNDS
DYITGQSILTDGGLVYR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaacagcaattataacaggtgcagcaggtggattaggtaaaggtattgcagaa
cgtcttgctaacgatgggtttaatatagtattacaagatattaatgaagcacttctatta
gaaactgagaaagaattcaaagaaaaaggttatcaagctgtcgcatacaagagtgatgta
tctaaaaagaaagaacaggaagaattagttcagttcgcagttacagaatttggtcaatta
gatgtcatggtgaataacgcaggtgttgatgcagtgacgccaattttagaaattggtgaa
gaggaattatctaagttatttaatattaacgtatttggtacattgtttggaattcaagca
gctgctaaccaatttattaaacaaaaaagtaaaggtaaaattatcaacgcatgtagtatt
gcaggacatgaatcttatgaagtactcggcacttactcagctacaaaacactctgtacgt
tccttcactcaaacagctgctaaagaattagcagacaaaggcattaccgtaaatgcttat
tgcccaggagttgccaaaactgaaatgtgggatcgtattgatgaagaaatggtgaaactt
gatgatagtctagaaataggagacgcgtttgaagcattttcttcagaaatcaaacttgga
agatatcaagagccatcagatgttgcgaacttagtatcattcttagcttcaaatgattct
gattatattacaggccaatccattttaactgatggtggattagtgtacagataa

DBGET integrated database retrieval system