KEGG   Staphylococcus epidermidis ATCC 12228: SE0197Help
Entry
SE0197            CDS       T00110                                 

Definition
acetoin(diacetyl)reductase
Orthology
K03366  
meso-butanediol dehydrogenase / (S,S)-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.- 1.1.1.76 1.1.1.304]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    SE0197
Enzymes [BR:sep01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.76  (S,S)-butanediol dehydrogenase
     SE0197
    1.1.1.304  diacetyl reductase [(S)-acetoin forming]
     SE0197
    1.1.1.-  
     SE0197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
188759..189532
Genome map
AA seq 257 aa AA seqDB search
MSKTAIITGAAGGLGKGIAERLANDGFNIVLQDINEALLLETEKEFKEKGYQAVAYKSDV
SKKKEQEELVQFAVTEFGQLDVMVNNAGVDAVTPILEIGEEELSKLFNINVFGTLFGIQA
AANQFIKQKSKGKIINACSIAGHESYEVLGTYSATKHSVRSFTQTAAKELADKGITVNAY
CPGVAKTEMWDRIDEEMVKLDDSLEIGDAFEAFSSEIKLGRYQEPSDVANLVSFLASNDS
DYITGQSILTDGGLVYR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaacagcaattataacaggtgcagcaggtggattaggtaaaggtattgcagaa
cgtcttgctaacgatgggtttaatatagtattacaagatattaatgaagcacttctatta
gaaactgagaaagaattcaaagaaaaaggttatcaagctgtcgcatacaagagtgatgta
tctaaaaagaaagaacaggaagaattagttcagttcgcagttacagaatttggtcaatta
gatgtcatggtgaataacgcaggtgttgatgcagtgacgccaattttagaaattggtgaa
gaggaattatctaagttatttaatattaacgtatttggtacattgtttggaattcaagca
gctgctaaccaatttattaaacaaaaaagtaaaggtaaaattatcaacgcatgtagtatt
gcaggacatgaatcttatgaagtactcggcacttactcagctacaaaacactctgtacgt
tccttcactcaaacagctgctaaagaattagcagacaaaggcattaccgtaaatgcttat
tgcccaggagttgccaaaactgaaatgtgggatcgtattgatgaagaaatggtgaaactt
gatgatagtctagaaataggagacgcgtttgaagcattttcttcagaaatcaaacttgga
agatatcaagagccatcagatgttgcgaacttagtatcattcttagcttcaaatgattct
gattatattacaggccaatccattttaactgatggtggattagtgtacagataa

DBGET integrated database retrieval system