KEGG   Staphylococcus epidermidis ATCC 12228: SE0208Help
Entry
SE0208            CDS       T00110                                 

Definition
opp-1C protein
Orthology
K15586  
nickel transport system permease protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
ABC transporters
Module
Nickel transport system
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:sep02010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
196528..197406
Genome map
AA seq 292 aa AA seqDB search
MIVLRRLFQDRGAIFAIAIITIYVVLGVLAPLITFYEPNHIDTANKFAGISWSHWLGTDH
LGRDVLTRIIYAIRPSLLYVFVALIISVVIGAILGFISGYFPGYIDAIIMRICDVMLAFP
SYVVTLALITLFGMGVENIIIAFILTRWAWFCRVIRTSVMQYIEADHVKFAKVIGMNDLT
IIRKHILPLTFTDIAIIASSSMCSMILQMSGFSFLGLGVKAPTAEWGMMLNEARKVMFTH
PGMMMTTGVAIVIIVMAFNFLSDALQMAIDPRMSAKEKRLALKKGVKARDTA
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgattgtgttacgtcgtctatttcaagatagaggtgccatatttgctatagctattatt
acaatctacgtagtgcttggagttttagctcctttaattacattctatgaaccgaatcac
attgatacagcaaataaatttgctggtataagttggtctcactggttgggaacagaccat
ttaggtcgagatgtattaacacggataatatacgccataagacctagtttgttatatgta
tttgtcgcattgattatttccgttgtgataggagcgatacttgggtttatttcaggttat
ttcccaggttatatcgatgcaataattatgcgtatatgcgatgtgatgttagcttttcca
agctatgtggtgacattggcattgattacgttgtttggcatgggtgtagaaaatattatt
attgcgtttatattgactcgatgggcgtggttttgtcgcgtgattcgaaccagtgtaatg
caatatattgaagctgatcatgtaaaatttgccaaagtaattggtatgaatgatttaaca
atcattcgcaaacatattttgccactaacctttactgacatagcgattattgctagtagt
tcgatgtgttcaatgatattacaaatgtcaggattctcattccttggattaggtgttaag
gcacctacagccgaatgggggatgatgcttaatgaagcacgaaaagtaatgttcacacat
cctggaatgatgatgacaacaggtgtggctatcgtcataattgtgatggcgtttaacttt
ttatcagatgctttacaaatggcgattgatcctcgtatgtccgctaaagaaaaacgactg
gctctgaagaaaggtgtgaaagcacgtgacactgcttaa

DBGET integrated database retrieval system