KEGG   Staphylococcus epidermidis ATCC 12228: SE0208Help
Entry
SE0208            CDS       T00110                                 

Definition
(RefSeq) opp-1C protein
  KO
K15586  nickel transport system permease protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
sep02010  ABC transporters
Module
sep_M00440  Nickel transport system
Brite
KEGG Orthology (KO) [BR:sep00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SE0208
Transporters [BR:sep02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Nickel transporter [MD:M00440] [OT]
    SE0208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 OppC_N CM2
Motif
Other DBs
NCBI-GeneID: 1056350
NCBI-ProteinID: NP_763763
UniProt: A0A0H2VEI5
Position
196528..197406
Genome map
AA seq 292 aa AA seqDB search
MIVLRRLFQDRGAIFAIAIITIYVVLGVLAPLITFYEPNHIDTANKFAGISWSHWLGTDH
LGRDVLTRIIYAIRPSLLYVFVALIISVVIGAILGFISGYFPGYIDAIIMRICDVMLAFP
SYVVTLALITLFGMGVENIIIAFILTRWAWFCRVIRTSVMQYIEADHVKFAKVIGMNDLT
IIRKHILPLTFTDIAIIASSSMCSMILQMSGFSFLGLGVKAPTAEWGMMLNEARKVMFTH
PGMMMTTGVAIVIIVMAFNFLSDALQMAIDPRMSAKEKRLALKKGVKARDTA
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgattgtgttacgtcgtctatttcaagatagaggtgccatatttgctatagctattatt
acaatctacgtagtgcttggagttttagctcctttaattacattctatgaaccgaatcac
attgatacagcaaataaatttgctggtataagttggtctcactggttgggaacagaccat
ttaggtcgagatgtattaacacggataatatacgccataagacctagtttgttatatgta
tttgtcgcattgattatttccgttgtgataggagcgatacttgggtttatttcaggttat
ttcccaggttatatcgatgcaataattatgcgtatatgcgatgtgatgttagcttttcca
agctatgtggtgacattggcattgattacgttgtttggcatgggtgtagaaaatattatt
attgcgtttatattgactcgatgggcgtggttttgtcgcgtgattcgaaccagtgtaatg
caatatattgaagctgatcatgtaaaatttgccaaagtaattggtatgaatgatttaaca
atcattcgcaaacatattttgccactaacctttactgacatagcgattattgctagtagt
tcgatgtgttcaatgatattacaaatgtcaggattctcattccttggattaggtgttaag
gcacctacagccgaatgggggatgatgcttaatgaagcacgaaaagtaatgttcacacat
cctggaatgatgatgacaacaggtgtggctatcgtcataattgtgatggcgtttaacttt
ttatcagatgctttacaaatggcgattgatcctcgtatgtccgctaaagaaaaacgactg
gctctgaagaaaggtgtgaaagcacgtgacactgcttaa

DBGET integrated database retrieval system